SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P63010 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P63010
Domain Number 1 Region: 6-580
Classification Level Classification E-value
Superfamily ARM repeat 4.12e-150
Family Clathrin adaptor core protein 0.00000000000000835
Further Details:      
 
Domain Number 2 Region: 825-937
Classification Level Classification E-value
Superfamily Subdomain of clathrin and coatomer appendage domain 8.24e-52
Family Clathrin adaptor appendage, alpha and beta chain-specific domain 0.00000047
Further Details:      
 
Domain Number 3 Region: 707-823
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 9.07e-43
Family Alpha-adaptin ear subdomain-like 0.000000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P63010
Sequence length 937
Comment (sp|P63010|AP2B1_HUMAN) Plasma membrane adaptor HA2/AP2 adaptin beta subunit KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=AP2B1; OC=Catarrhini; Hominidae; Homo.
Sequence
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANA
VAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQY
VALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQV
QLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEV
VLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGST
DAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGL
DSLVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKA
KGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQ
SIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLAT
WKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWIL
AELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
Download sequence
Identical sequences A0A061I2P5 A0A1U7QQA6 A0A287D4J0 A0A2K5JD63 A0A2K5LRZ0 A0A2K5V576 A0A2K6DW61 A0A2K6KX19 A0A2K6P5R3 F7FSU4 H9FQN1 K7CXZ7 P62944 P63010
NP_001273.1.87134 NP_001273.1.92137 XP_003414600.1.64505 XP_003511351.1.69978 XP_003953110.1.37143 XP_004385487.1.4749 XP_004414832.1.74151 XP_004747183.1.14098 XP_005076998.1.91757 XP_005583528.1.63531 XP_005624854.1.84170 XP_005973053.1.78601 XP_006995373.1.50099 XP_007096111.1.5354 XP_007105628.1.24612 XP_008009260.1.81039 XP_008523806.1.77740 XP_008693632.1.72690 XP_008766161.1.100692 XP_008846358.1.79516 XP_008969510.1.60992 XP_008995315.1.60252 XP_010383506.1.97406 XP_010947463.1.22495 XP_010988813.1.51371 XP_011287267.1.62641 XP_011745639.1.29376 XP_011807241.1.43180 XP_011923128.1.92194 XP_012642446.1.48125 XP_013212497.1.77405 XP_014406246.1.101512 XP_014717713.1.49734 XP_014933940.1.86478 XP_014974574.1.72884 XP_015107507.1.17985 XP_015350794.1.40921 XP_016879773.1.92137 XP_017746484.1.44346 XP_019279512.1.44245 ENSP00000262325 ENSP00000474435 ENSCJAP00000027488 gi|4557469|ref|NP_001273.1| ENSP00000482315 ENSRNOP00000013363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]