SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for P63020 from Uniprot 2014_06

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P63020
Domain Number 1 Region: 95-184
Classification Level Classification E-value
Superfamily Fe-S cluster assembly (FSCA) domain-like 2.14e-25
Family NifU C-terminal domain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 1-97
Classification Level Classification E-value
Superfamily HesB-like domain 2.16e-20
Family HesB-like domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
metal ion homeostasis 1.489 7.67
cellular chemical homeostasis 1.467 7.67
cellular iron ion homeostasis 2.021 7.67
protein maturation 1.681 5.4
Molecular Function IC (bits) H-Score
metal cluster binding 2.094 26.07
iron ion binding 2.227 14.67
Cellular Component IC (bits) H-Score
plastid 1.6 6.54
chloroplast part 1.896 6.54
plastid stroma 2.025 6.43
mitochondrial matrix 1.714 4.72

Protein sequence

External link(s) P63020
Sequence length 191
Comment (sp|P63020|NFUA_ECOLI) Fe/S biogenesis protein NfuA KW=Complete proteome; Reference proteome OX=83333 OS=Escherichia coli (strain K12). GN=nfuA OC=Enterobacteriaceae; Escherichia.
Sequence
MIRISDAAQAHFAKLLANQEEGTQIRVFVINPGTPNAECGVSYCPPDAVEATDTALKFDL
LTAYVDELSAPYLEDAEIDFVTDQLGSQLTLKAPNAKMRKVADDAPLMERVEYMLQSQIN
PQLAGHGGRVSLMEITEDGYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGVRDL
TEHQRGEHSYY
Download sequence
Identical sequences A0A009EKR8 A0A017I3X0 A0A017I4W9 A0A017I706 A0A017J8I8 A0A017JDQ2 A0A017JNB6 A0A017KIT4 A0A017L357 A0A017L9T1 A0A017LD25 A0A017MDV8 A0A017MFN2 A0A022HGS4 A1AGT8 A7ZSU3 A8A5M2 B1EI66 B1IP51 B1LHL4 B1X760 B2N8W7 B2NLD7 B2P0D8 B2PGW8 B2U3M4 B3A1B8 B3AFT7 B3AWB4 B3BCD3 B3BQW2 B3HEB0 B3HQK2 B3HZP1 B3IJF9 B3WJ94 B3X8J9 B5YTW5 B6I2X8 B6ZTD6 B7L4U4 B7LSB7 B7M1X0 B7MDP0 B7N147 B7NE19 B7UKB9 C1HRX1 C2DIT6 C3SPY2 C4ZVW3 C6EFG0 C6UG14 C6UVH9 C8TJK4 C8TY30 C8UHP5 C9QWL9 D2A9L8 D2NBJ6 D3GZN2 D3QTN1 D5D2X6 D6I292 D6IEU7 D6IVF4 D6JFZ1 D7JU75 D7X8R5 D7XWA6 D7Y606 D7YQK4 D7Z1A7 D7ZAF4 D7ZWX2 D8A6T3 D8AIA4 D8B3U1 D8BJG6 D8BVW3 D8CIX1 D8E819 D8EG75 E0IZV8 E0R603 E1HN05 E1I6V3 E1IP07 E1J1W9 E1PHL9 E1S560 E2JW35 E2K9K0 E2KLS8 E2WWY4 E2X8W3 E3PLM0 E3XSV1 E3Y874 E4PC95 E5ZXN5 E6ACT4 E6AWI8 E6BBY6 E6BIH0 E7HHE7 E7HR55 E7I6V1 E7IPU5 E7J9Z9 E7JLM5 E7K635 E7SIT7 E7TBG4 E7U1G2 E7ULU3 E8H7U3 E8HLU8 E8I0G6 E8IEL6 E8ISI4 E8J7K2 E8YDQ4 E9TFS1 E9TSH1 E9U7B4 E9VDS6 E9VUS3 E9W7V1 E9WMC8 E9X0K9 E9XDJ7 E9XTA3 E9Y6D7 E9YJW7 E9YVE1 E9ZCJ1 F0JU64 F1XX47 F1Y290 F1ZNE9 F3U609 F3W368 F3WNW2 F4M546 F4NNC8 F4SQE5 F4TLF5 F4TZE3 F4UEQ0 F4UUF6 F4V7B1 F4VK50 F4W0U4 F5MU82 F5NA40 F5NP30 F5P316 F5PJA5 F5PYS9 F5QDF8 F5QRU6 F5R643 F7N230 F7RFY8 F8X8W3 F8YKX2 F9CN13 F9I0F7 F9QZU2 G0D4C7 G0F783 G1YFA0 G1YVV1 G1ZAT5 G1ZPW4 G2A5D6 G2ALN2 G2B0Q5 G2BEW5 G2BVL6 G2CA70 G2CRF5 G2D4Y8 G2F483 G4PU33 G5KTN4 G5TPL0 G5U3M8 G5UDY3 G5UXP6 G5VF77 G5VV16 G5WBN7 G5WJU0 G5WZ49 G5XIU9 G5Y2L7 G5Y7Y1 G7REQ0 G7RN73 H0Q7F6 H1C0P0 H1DVC1 H1E4T5 H1ER60 H1F9W2 H1FL84 H3KUT7 H4I262 H4IH79 H4IY59 H4JE19 H4JT68 H4K8K3 H4KN13 H4L412 H4LI87 H4LZC3 H4MEN0 H4MXB4 H4NDL1 H4NUJ7 H4PB16 H4PR32 H4Q6U9 H4QNR4 H4R5W4 H4RLI2 H4S1V6 H4SHE3 H4SYI9 H4TDW8 H4TU76 H4U9K5 H4UQC7 H4V728 H4VMA2 H4W2H3 H4WGT6 H4WX79 H4XAX5 H4XRM2 H4Y7D8 H4YLJ9 H4Z2A6 H4ZK63 H5A3A6 H5AJQ1 H5B1A0 H5BGI3 H5BX80 H5CC83 H5CSJ1 H5D9H0 H5DQH3 H5E825 H5EQ13 H5F6Y3 H5FKI4 H5G388 H5GI29 H5GY18 H5HDN8 H5HVK2 H5I9U3 H5IQ47 H5J7P9 H5JPF3 H5K4V8 H5KKB7 H5KZS2 H5LCE3 H5LST2 H5M6X3 H5MLL3 H5MZZ4 H5NFD8 H5NW61 H5PAC5 H5PQQ1 H5Q565 H5QKP2 H5QZN5 H5RFH0 H6MI16 H8DE59 H9UXU2 I0VHT9 I0VW53 I0ZX47 I1B6N8 I2A181 I2I394 I2PHZ8 I2PIX5 I2QWA3 I2RF39 I2RT94 I2S7Z2 I2SV40 I2T5N0 I2TRE3 I2U3I0 I2UI68 I2V140 I2VK13 I2W2K0 I2WEL5 I2X038 I2X5K2 I2XV39 I2Y863 I2YPZ3 I2Z221 I2ZJ82 I2ZNL2 I3A8N3 I4J6I8 I4NIF6 I4NR78 I4PCL4 I4Q7J8 I4QGV6 I4QSF3 I4RFI2 I4RRA4 I4SLE7 I4SRW6 I4T7R1 I4TNR9 I4U2F4 I4U5U4 I4UVP8 I4UWR5 I5DEJ3 I5DIP5 I5DJM0 I5EUJ2 I5EV17 I5F3Q9 I5G436 I5GDF5 I5GMH4 I5HHH5 I5HUH3 I5HWD7 I5IWD7 I5JFC8 I5JJT8 I5JX07 I5KX09 I5KYZ6 I5L7M2 I5M7A7 I5MQJ8 I5MUU9 I5MZQ2 I5NY53 I5PJ02 I5PM48 I5Q3D7 I5QR59 I5QYF4 I5RP86 I5SEH0 I5SJ25 I5SSB7 I5TSZ1 I5TVY0 I5U8D3 I5UZZ1 I5VBU5 I5VNV0 I5WA45 I5WPE4 I5XE69 I5XKL1 I5XYI9 I5YKZ9 I5ZDK4 I5ZG52 I6B5J5 I6B7Z9 I6B9E3 I6CB07 I6CL79 I6D0Z6 I6DMD9 I6DZP4 I6E8L0 I6F2U5 I6FDH7 I6FJW1 I6FWL1 I6GHL6 J2FKR5 J2XHI3 J2Z1G8 J7QS21 J9ZG43 K0AHW1 K0BUF7 K0XB25 K2XM11 K2XVI1 K2Y758 K2YPV1 K2ZUR4 K3A3N1 K3B262 K3B2M5 K3B9F4 K3BKB6 K3C0G7 K3D3I5 K3DJI6 K3DSQ7 K3ECF4 K3EEQ4 K3EXR0 K3GBB6 K3GDW3 K3GTR4 K3H3K1 K3IDQ7 K3IGV9 K3IIS5 K3J8W8 K3JCT2 K3KBM7 K3KDX9 K3KHP3 K3KLS8 K3LY11 K3MIT2 K3MTL3 K3NAX3 K3NVR0 K3P8P2 K3PUV2 K3Q9X8 K3QIG2 K3REW7 K3RGN0 K3RIK8 K3SNX3 K3SSP7 K3SWF6 K3TAM0 K3UED2 K4UTK1 K4VG11 K4VPN7 K4VQR8 K4XBH6 K4XRT3 K4XTX1 K4XUQ0 K5BMF0 K5EXC2 K5F0M1 K5G065 K5GB06 K5GBW7 K5GE84 K5GFT2 K5GNB2 K5I6T7 K5IXF8 K5IZJ7 K5K4U0 L0XAT7 L0XEI8 L0XLI0 L0YJ31 L0YTY2 L0Z3I8 L1A3X1 L1A4U6 L1AGT0 L1BJA9 L1BLE3 L1BTZ6 L1CSL3 L1CYR7 L1DAW8 L1DX40 L1EGR6 L1EMJ5 L1FDZ7 L1FP24 L1G0V7 L1GQ60 L1GUA9 L1R867 L1RC46 L1V2Q8 L1VW39 L1VZY6 L1X716 L1XD19 L1XL61 L1YGE3 L1YPW8 L1YTU2 L1ZK57 L1ZN69 L1ZYX0 L2ALV8 L2AVJ1 L2BD23 L2BP35 L2C2L7 L2CMG5 L2D2R9 L2DCR7 L2DTI3 L2E765 L2U2J4 L2U5B0 L2UT68 L2VFC7 L2VMP1 L2VVD6 L2WF85 L2WHS9 L2X4U6 L2X832 L2XXX4 L2Y7M1 L2YPI4 L2Z0A4 L2ZDH2 L3A2D1 L3A5K8 L3ARP5 L3B0M2 L3BH89 L3C2L3 L3C7Z2 L3CQA8 L3D4X4 L3DGE8 L3DX59 L3E3P9 L3EQ38 L3F2C2 L3F9K5 L3FNB4 L3GAJ1 L3GJK2 L3H8H9 L3H962 L3HZ57 L3I768 L3IMU5 L3J1T2 L3JD79 L3JQ41 L3K6E2 L3KAX0 L3KXS7 L3LDJ9 L3M0A3 L3M4D2 L3MCS9 L3MYF0 L3N6G5 L3NNZ7 L3NVX6 L3PJ50 L3PXY0 L3QC12 L3QMC2 L3R6X2 L3RBH0 L3RZR4 L3S0Q9 L3SS53 L3STM7 L3TGD6 L3TKD9 L3UCF2 L3UL16 L3V1M0 L3V5W0 L3W0K2 L3WEC4 L3WKW4 L3WR13 L3XLQ6 L3XTX5 L3Y2K5 L3Y985 L3YXU9 L3YYE7 L3ZMV2 L3ZNK9 L4AB13 L4AMJ5 L4B5J0 L4BKX8 L4BN69 L4CRG5 L4CWA5 L4D0Q8 L4D303 L4DVC7 L4E089 L4EML7 L4EZA1 L4F988 L4FUR1 L4FXT7 L4G784 L4H6E3 L4HEE0 L4HG63 L4HQC5 L4I6E9 L4IM15 L4IYR2 L4JHL2 L4JV20 L4K667 L4KMP6 L4KYT0 L4L7A2 L4LJA9 L4LKD1 L4LXA9 L4MZE0 L4NF53 L4NGY4 L4NT90 L4P9D6 L4PRS5 L4Q038 L4QQV6 L4QXY5 L4R923 L4RVP2 L4S149 L4SC46 L4T637 L4TKC1 L4TLL1 L4TZU0 L4UL89 L4V4H9 L4V6T3 L4VLF5 L4W792 L4WI00 L4WKE9 L4XH45 L4XJY4 L4XWT8 L4YJK2 L4YVK9 L4ZMF4 L5A042 L5A9L9 L5AUW8 L5AZR4 L5BEL2 L5C174 L5C6F8 L5CDF8 L5D527 L5DD15 L5DJJ5 L5E977 L5EI68 L5ERV1 L5FIP4 L5FK85 L5FZ30 L5GP85 L5GY63 L5GYN9 L5HSR2 L5I262 L5I8N5 L5IYI4 L5JA78 L5VIS8 L8BZM3 L8C905 L8CMH0 L8YJ18 L8YMK8 L8ZBS6 L8ZY83 L8ZZM6 L9AAW3 L9B3S9 L9BDK7 L9BJF9 L9CMA3 L9CQM2 L9CRU0 L9DNL5 L9DVM1 L9ED67 L9EZS9 L9EZY0 L9FNA9 L9G605 L9GDY2 L9GRC8 L9HG99 L9HW04 L9I8E2 L9INP3 M2NL93 M2NP29 M2P7Q3 M4JRC1 M5H9H4 M5I614 M5I930 M7VA33 M7VCC6 M7VJ16 M7VK41 M8JVG3 M8KHR9 M8LBA8 M8LHU0 M8M0N0 M8MDW7 M8MF94 M8N5T7 M8NL46 M8P6N7 M8PHK9 M8QEG4 M8QIJ2 M8QTB2 M8QU11 M8RA74 M8S8X8 M8SDJ5 M8SIY8 M8SQA9 M8TRD7 M8TYG6 M8UMB8 M8VZF2 M8W216 M8WAR5 M8WF29 M8WV29 M8XD22 M8XL00 M8XLA9 M8YPM9 M8YQJ1 M9AE86 M9B387 M9B9R4 M9BUB7 M9BVU1 M9CG77 M9CQG3 M9CRU1 M9DR39 M9EC83 M9EKD3 M9EUL7 M9F2Q2 M9FBP1 M9FNL5 M9GTR2 M9HKJ6 M9HSC7 M9IEN3 M9IQQ0 M9ISG8 M9IV27 M9IVE2 M9K4N6 M9K6Y8 M9KUZ4 N1SF82 N1SV58 N1T721 N2BEM4 N2DDQ2 N2DDQ5 N2DEZ3 N2EJ88 N2ER27 N2EWT5 N2FSA9 N2G494 N2GGG9 N2GXN7 N2H8P5 N2HK76 N2HWF3 N2IL79 N2JJZ1 N2K3J7 N2KE12 N2KJW0 N2LDC9 N2LKJ3 N2LMI1 N2MSU1 N2MTL8 N2MVT6 N2NTV0 N2P1Y0 N2P6Y2 N2PZ58 N2QGX8 N2QK32 N2R8V7 N2RR08 N2S5U4 N2SHD5 N2SM27 N2TC97 N2TUY4 N2U3D7 N2UE54 N2UI31 N2UN52 N2VRF9 N2VUG3 N2VWI9 N2WM90 N2X782 N2XUK5 N2YJ33 N2YUP9 N2Z3B6 N2ZKR0 N3A4N6 N3AH99 N3AU46 N3BD32 N3CEI6 N3DEP8 N3DFB9 N3EM59 N3EXM0 N3F1B7 N3FQS1 N3G5S1 N3GG60 N3GZC4 N3HUB5 N3HUH1 N3IJ54 N3IWH4 N3J4X4 N3K8Z7 N3KHE8 N3L6T5 N3LDP3 N3LLV5 N3M1J9 N3M9H6 N3NGN6 N3NHA7 N3NV42 N3PFP2 N3PGZ3 N3PUL1 N3QPQ1 N3R431 N3RKF9 N3RP39 N3SDD6 N3SR44 N3SUG7 N3TVE6 N3TYW8 N3UBJ6 N3V1E6 N3VHW1 N3VRV1 N3W9P9 N3WFV9 N3X8G1 N3XH24 N3XKC6 N3YF53 N3YJX8 N3ZDC0 N3ZX83 N4A3U7 N4A5L3 N4B6E6 N4BB55 N4BF43 N4CG67 N4CGX0 N4CXA1 N4E2W4 N4E992 N4EC30 N4EX46 N4F9F0 N4FGL7 N4GHA4 N4GIH4 N4GLC4 N4HM94 N4HUP4 N4HWL6 N4ISM5 N4IVQ1 N4JHH2 N4KAN5 N4KJY9 N4KX04 N4LNT1 N4MB73 N4MYZ8 N4NDX3 N4NF59 N4PCH6 N4PYU7 N4Q4I4 N4Q7J7 N4QWI7 N4RBV3 N4RPF4 N4SEU0 N4SFG7 N4SWG1 N6WF02 P63020 P63021 P63022 P63023 Q0SZQ1 Q0TC53 Q1R5M0 Q31VL8 Q32AM7 Q3YWL1 R6U1T9 R8XGI2 R9ESF6 S0SIW9 S0SNU1 S0SUL9 S0TTQ4 S0U0I7 S0U1R8 S0V424 S0VA07 S0VQ24 S0VQ37 S0WCA0 S0WVN0 S0XH85 S0XIW0 S0XME9 S0YBP1 S0YHL4 S0YXF5 S0ZHG4 S0ZV69 S1A4U0 S1ARM8 S1BIC4 S1BWP7 S1CJ63 S1D5H0 S1D5M3 S1D701 S1DV60 S1EAJ2 S1ELF9 S1F7B0 S1FH78 S1G278 S1GJD6 S1H1T0 S1HHZ9 S1HIQ3 S1HTE2 S1IKR3 S1INE5 S1JE88 S1JJX0 S1JQM3 S1KLF3 S1KVQ3 S1L518 S1LP58 S1M8N1 S1MIQ9 S1NWH8 S1P8Z8 S1PE96 S1PYZ8 S1QTW6 S1R614 S1RG82 S1SGK6 S4A819 T2G2H9 T2MW45 T5LZ00 T5M853 T5MJD6 T5MY52 T5N6M9 T5NVU5 T5P019 T5PD72 T5PQZ9 T5QID3 T5QP83 T5R3Q1 T5RSB8 T5RZV7 T5SGI6 T5SJF2 T5T0L3 T5TUL9 T5TXZ8 T5UGG0 T5UIM9 T5VD75 T5VHP6 T5W8W7 T5WED1 T5WX65 T5X6V7 T5XP92 T5YIF5 T5YT22 T5ZRF6 T5ZZW7 T6ACZ6 T6AQP0 T6BFB0 T6BFI9 T6BT25 T6CKN7 T6CUI9 T6DGT6 T6DLH3 T6E1G6 T6E5B7 T6EVK9 T6FAA3 T6FHY6 T6FKP7 T6GSX6 T6HDI3 T6HYM2 T6IJF4 T6J2V8 T6J3F4 T6JNI3 T6K5F8 T6KN61 T6KUZ8 T6LB01 T6LIG5 T6LVE7 T6M019 T6MJ63 T6NHC2 T6NPZ1 T6NYA0 T6P986 T6PB59 T6PZF0 T6QKM8 T6QWP6 T6RMW8 T6RSH2 T6RUP4 T6SLL9 T6T7T6 T6TBB0 T6TLR8 T6TW69 T6UK25 T6USN5 T6V713 T6VVL9 T6W4K3 T6WJ96 T6WQQ1 T6X4R6 T6Y4P8 T6YL42 T6YUX5 T6Z168 T6Z7X2 T7A152 T7AY56 T7B0I0 T7B3R2 T7BTW7 T7C1H1 T7CBJ9 T7CCB7 T7CJ43 T7DFK0 T7DKK3 T7DTG6 T7ES88 T7F702 T7FLE6 T7G3I1 T7GEA9 T7GQB4 T7GV73 T7HQP7 T7ICR8 T7IX56 T7JBL1 T7JSG8 T7JZI8 T7KEH3 T7KIK0 T7KR04 T7L5S2 T7M0K9 T7M1C5 T7MJJ9 T7NJG5 T7NYI6 T7PT07 T7Q0L0 T7Q274 T7Q9G5 T7R523 T7S1N3 T7S9S1 T7SFB6 T7SR55 T7TLS0 T7TQH4 T7UIR4 T7V741 T7VAJ1 T7W2A7 T7W2T0 T7WCU5 T7WEC2 T7X0B5 T7XEW2 T7XI01 T7YGI7 T7YNL2 T7ZAA3 T7ZFS2 T8AGM8 T8APV3 T8AXG3 T8BES1 T8BXN2 T8CDY1 T8D1T9 T8D220 T8DIY4 T8DJF7 T8E2X2 T8E5V4 T8EGK0 T8G1C8 T8G398 T8G491 T8G5W2 T8GXH4 T8H3W7 T8H537 T8HY57 T8IIY3 T8IYT7 T8J894 T8JMW2 T8KEB5 T8KJX3 T8KRG9 T8L0X2 T8LLS0 T8M3Z0 T8MAE9 T8N3C2 T8N5H0 T8NYG0 T8P208 T8P338 T8Q1M9 T8QIZ5 T8QXZ7 T8R0J8 T8R190 T8RKY4 T8S0H6 T8SMM6 T8T3S7 T8TUT4 T8U0G7 T8UIZ6 T8ULI8 T8V9L9 T8VAQ7 T8VBP4 T8VK55 T8VNF4 T8WFF5 T8WHA0 T8XN42 T8XYL4 T8Y3Y7 T8YC13 T8YCC0 T8ZEM2 T8ZUX6 T8ZYV4 T9AY73 T9BKC4 T9BXQ8 T9BZ16 T9CLG2 T9CVQ9 T9D7A9 T9DFE6 T9DQC6 T9EK51 T9ELL9 T9ELV7 T9F5E4 T9FZ87 T9G9Y7 T9GE96 T9GFQ3 T9HBD9 T9HTI8 T9HWU7 T9IAD3 T9IVJ2 T9IXD4 T9J4R8 T9JU48 T9K4S8 T9KC60 T9KWG0 T9LHQ0 T9LNZ5 T9M0T1 T9NDP8 T9NFT8 T9NGQ0 T9NLK8 T9P888 T9PJ64 T9PNA5 T9Q1K5 T9QMM6 T9R0A1 T9REP2 T9S336 T9SJL1 T9SMS2 T9T2L8 T9TGB3 T9TQS5 T9U0Z9 T9USB9 T9V4S1 T9VFF0 T9WQY5 T9X5M8 T9XB61 T9Y6Z2 T9YDA0 T9YWK1 T9YZD7 T9Z5Y8 T9ZB11 U0AL49 U0AMR9 U0AVE6 U0AWB8 U0BGT2 U0C305 U0CH95 U0CJ23 U0DEV2 U0EC33 U0F4X5 U0GAR2 U0GC70 U0GN57 U0H607 U0HRS2 U0I4U3 U0IGI2 U0IRF9 U0IRW8 U0K1E6 U0KFI7 U0KHJ4 U0KWX1 U0LF68 U0LVC1 U0M686 U0NA32 U0ND47 U0P0J8 U0P248 U0PKK1 U0QC62 U0REN2 U0RLD9 U0RM46 U0RSE0 U0RU54 U0S0J3 U0T0I8 U0T4Z6 U0U6Q5 U0UFT6 U0UGB6 U0UHE3 U0VMH6 U0VSN9 U0VZW3 U0XUJ8 U0Y004 U0Y4W4 U0YIC2 U0ZDD5 U0ZG15 U1A600 U1ABU8 U1B3X3 U1BAQ3 U1BIL5 U1CC96 U1CSU7 U1G1P3 U1I5B0 U1JNZ6 U3G1Z6 U5B985 U5M4F7 U5SLJ9 U6NFH2 U7BSM1 U7CCM3 U9V5C8 U9VE61 U9XJV4 U9Y553 U9YG43 U9Z6M6 V0A3V1 V0A8A4 V0AZF8 V0R7D4 V0RHX3 V0RTR9 V0SCE8 V0SVX8 V0TL86 V0TU38 V0UEG7 V0UYQ1 V0V0L7 V0VGP9 V0WW19 V0WYI0 V0X680 V0XEY5 V0Y4M8 V0YEI2 V0YQN0 V0Z7C9 V0ZNH4 V1A7W6 V1ALC2 V1AR31 V1C263 V1CKB3 V1CQ60 V1CTF3 V1D360 V2QP03 V2QW01 V2RA05 V2RLW5 V2RTV7 V2SHL4 V2TUL2 V2UCY2 V2YUY0 V2ZIH7 V3B3P7 V3I392 V4C693 V4CKS5 V4CWJ9 V4D951 V4DG61 V4E585 V4ECT5 V4F6Z9 V4FTM5 V4XBN2 V5DFF6 V5DYY4 V5E711 V6E1M9 V6EG27 V6FCZ6 V6FU57 V6N326 V6N4D6 V6N5Q0 V6P5C3 V6PZP8 V6Q0J9 V6WLM9 V8F752 V8FI82 V8IUH2 V8JMV4 V8JNN7 V8L499 V8LAV8 V8RUP9 V8SE55 V8SSH8 V8T079 V8TCH8 W0AS75 W0KHN6 W0L3A7 W0ZLY3 W1B9E2 W1BXV2 W1C301 W1D8J0 W1ETQ0 W1GH22 W1SWD8 W1T6Y8 W1WLZ1 W2AHP4 W3V0Y1 W7IA18 W8ZXG6 X7IYP2 X7JM93 X7JQM0 X7JZE1 X7KN84 X7L966 X7LKC2 X7M560 X7MKM0 X7N2P4 X7N830 X7NSE8 X7P1H0 X7PGL5 X7Q5D5 X7QC17 X7QSE2
gi|218691690|ref|YP_002399902.1| gi|407479979|ref|YP_006777128.1| gi|170082930|ref|YP_001732250.1| gi|91212889|ref|YP_542875.1| gi|24114681|ref|NP_709191.1| gi|386711294|ref|YP_006175015.1| gi|218697097|ref|YP_002404764.1| gi|157155730|ref|YP_001464872.1| gi|386641008|ref|YP_006107806.1| gi|187731025|ref|YP_001882093.1| gi|209396437|ref|YP_002272850.1| gi|253771757|ref|YP_003034588.1| gi|387831289|ref|YP_003351226.1| gi|260846198|ref|YP_003223976.1| gi|386616198|ref|YP_006135864.1| gi|386711294|ref|YP_006175015.1| gi|260857521|ref|YP_003231412.1| gi|387614088|ref|YP_006117204.1| gi|388479824|ref|YP_492018.1| gi|82778770|ref|YP_405119.1| gi|218560472|ref|YP_002393385.1| gi|238902505|ref|YP_002928301.1| gi|378711159|ref|YP_005276052.1| gi|254163342|ref|YP_003046450.1| gi|471334944|ref|YP_007558421.1| gi|218707005|ref|YP_002414524.1| gi|218555963|ref|YP_002388876.1| APC28291 ET33 gi|386621055|ref|YP_006140635.1| gi|556553295|ref|YP_008723777.1| gi|251786664|ref|YP_003000968.1| gi|110643647|ref|YP_671377.1| gi|26250015|ref|NP_756055.1| gi|407471365|ref|YP_006782192.1| gi|387884563|ref|YP_006314865.1| gi|378711159|ref|YP_005276052.1| gi|386631297|ref|YP_006151017.1| gi|209920872|ref|YP_002294956.1| gi|387508782|ref|YP_006161038.1| gi|386636217|ref|YP_006155936.1| gi|386601427|ref|YP_006102933.1| gi|30065301|ref|NP_839472.1| 155864.Z4769 198214.SF3437 198215.S4328 199310.c4191 300267.SDY_3662 300268.SBO_3403 300269.SSON_3546 316385.ECDH10B_3589 316407.gntY 331111.EcE24377A_3889 331112.EcHS_A3611 344609.SbBS512_E3795 362663.ECP_3500 364106.UTI89_C3915 373384.SFV_3422 386585.ECs4256 405955.APECO1_3052 409438.ECSE_3681 413997.ECB_03266 439855.EcSMS35_3695 444450.ECH74115_4721 469008.ECBD_0331 481805.EcolC_0299 511145.b3414 544404.ECSP_4364 573235.ECO26_4502 574521.E2348C_3659 585034.ECIAI1_3558 585035.ECS88_3803 585054.EFER_3383 585055.EC55989_3822 585056.ECUMN_3873 585395.ECO103_4132 585396.ECO111_4223 585397.ECED1_4075 595496.BWG_3105 gi|410480540|ref|YP_006768086.1| gi|291284750|ref|YP_003501568.1| gi|384544982|ref|YP_005729046.1| gi|215488695|ref|YP_002331126.1| gi|544391866|ref|YP_008566555.1| gi|218550672|ref|YP_002384463.1| gi|560159558|ref|YP_008852273.1| gi|110807249|ref|YP_690769.1| gi|544577950|ref|YP_008573474.1| gi|117625679|ref|YP_859002.1| gi|387623066|ref|YP_006130694.1| gi|170018350|ref|YP_001723304.1| gi|383180580|ref|YP_005458585.1| gi|386626202|ref|YP_006145930.1| gi|387623066|ref|YP_006130694.1| gi|170681204|ref|YP_001745662.1| gi|260870140|ref|YP_003236542.1| gi|443619477|ref|YP_007383333.1| gi|157162891|ref|YP_001460209.1| gi|74313917|ref|YP_312336.1| gi|254795329|ref|YP_003080166.1| gi|15833510|ref|NP_312283.1| gi|15803918|ref|NP_289954.1| gi|386706658|ref|YP_006170505.1| gi|251786664|ref|YP_003000968.1| gi|16131290|ref|NP_417873.1| gi|82545771|ref|YP_409718.1| gi|387609106|ref|YP_006097962.1| gi|387618701|ref|YP_006121723.1| gi|386605992|ref|YP_006112292.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]