SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for P63020 from Uniprot 2013_05

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P63020
Domain Number 1 Region: 95-184
Classification Level Classification E-value
Superfamily Fe-S cluster assembly (FSCA) domain-like 2.14e-25
Family NifU C-terminal domain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 1-97
Classification Level Classification E-value
Superfamily HesB-like domain 2.16e-20
Family HesB-like domain 0.0013
Further Details:      
 

Protein sequence

External link(s) P63020
Sequence length 191
Comment (sp|P63020|NFUA_ECOLI) Fe/S biogenesis protein NfuA KW=Complete proteome; Reference proteome OX=83333 OS=Escherichia coli (strain K12). GN=nfuA OC=Enterobacteriaceae; Escherichia.
Sequence
MIRISDAAQAHFAKLLANQEEGTQIRVFVINPGTPNAECGVSYCPPDAVEATDTALKFDL
LTAYVDELSAPYLEDAEIDFVTDQLGSQLTLKAPNAKMRKVADDAPLMERVEYMLQSQIN
PQLAGHGGRVSLMEITEDGYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGVRDL
TEHQRGEHSYY
Download sequence
Identical sequences A1AGT8 A7ZSU3 A8A5M2 B1EI66 B1IP51 B1LHL4 B1X760 B2N8W7 B2NLD7 B2P0D8 B2PGW8 B2U3M4 B3A1B8 B3AFT7 B3AWB4 B3BCD3 B3BQW2 B3HEB0 B3HQK2 B3HZP1 B3IJF9 B3WJ94 B3X8J9 B5YTW5 B6I2X8 B6ZTD6 B7L4U4 B7LSB7 B7M1X0 B7MDP0 B7N147 B7NE19 B7UKB9 C1HRX1 C2DIT6 C3SPY2 C4ZVW3 C6EFG0 C6UG14 C6UVH9 C8TJK4 C8TY30 C8UHP5 C9QWL9 D2A9L8 D2NBJ6 D3GZN2 D3QTN1 D5D2X6 D6I292 D6IEU7 D6IVF4 D6JFZ1 D7JU75 D7X8R5 D7XWA6 D7Y606 D7YQK4 D7Z1A7 D7ZAF4 D7ZWX2 D8A6T3 D8AIA4 D8B3U1 D8BJG6 D8BVW3 D8CIX1 D8E819 D8EG75 E0IZV8 E0R603 E1HN05 E1I6V3 E1IP07 E1J1W9 E1PHL9 E1S560 E2JW35 E2K9K0 E2KLS8 E2WWY4 E2X8W3 E3PLM0 E3XSV1 E3Y874 E4PC95 E5ZXN5 E6ACT4 E6AWI8 E6BBY6 E6BIH0 E7HHE7 E7HR55 E7I6V1 E7IPU5 E7J9Z9 E7JLM5 E7K635 E7SIT7 E7TBG4 E7U1G2 E7ULU3 E8H7U3 E8HLU8 E8I0G6 E8IEL6 E8ISI4 E8J7K2 E8YDQ4 E9TFS1 E9TSH1 E9U7B4 E9VDS6 E9VUS3 E9W7V1 E9WMC8 E9X0K9 E9XDJ7 E9XTA3 E9Y6D7 E9YJW7 E9YVE1 E9ZCJ1 F0JU64 F1XX47 F1Y290 F1ZNE9 F3U609 F3W368 F3WNW2 F4M546 F4NNC8 F4SQE5 F4TLF5 F4TZE3 F4UEQ0 F4UUF6 F4V7B1 F4VK50 F4W0U4 F5MU82 F5NA40 F5NP30 F5P316 F5PJA5 F5PYS9 F5QDF8 F5QRU6 F5R643 F7N230 F7RFY8 F8X8W3 F8YKX2 F9CN13 F9I0F7 F9QZU2 G0D4C7 G0F783 G1YFA0 G1YVV1 G1ZAT5 G1ZPW4 G2A5D6 G2ALN2 G2B0Q5 G2BEW5 G2BVL6 G2CA70 G2CRF5 G2D4Y8 G2F483 G4PU33 G5KTN4 G5TPL0 G5U3M8 G5UDY3 G5UXP6 G5VF77 G5VV16 G5WBN7 G5WJU0 G5WZ49 G5XIU9 G5Y2L7 G5Y7Y1 G7REQ0 G7RN73 H0Q7F6 H1C0P0 H1DVC1 H1E4T5 H1ER60 H1F9W2 H1FL84 H3KUT7 H4FN18 H4I262 H4IH79 H4IY59 H4JE19 H4JT68 H4K8K3 H4KN13 H4L412 H4LI87 H4LZC3 H4MEN0 H4MXB4 H4NDL1 H4NUJ7 H4PB16 H4PR32 H4Q6U9 H4QNR4 H4R5W4 H4RLI2 H4S1V6 H4SHE3 H4SYI9 H4TDW8 H4TU76 H4U9K5 H4UQC7 H4V728 H4VMA2 H4W2H3 H4WGT6 H4WX79 H4XAX5 H4XRM2 H4Y7D8 H4YLJ9 H4Z2A6 H4ZK63 H5A3A6 H5AJQ1 H5B1A0 H5BGI3 H5BX80 H5CC83 H5CSJ1 H5D9H0 H5DQH3 H5E825 H5EQ13 H5F6Y3 H5FKI4 H5G388 H5GI29 H5GY18 H5HDN8 H5HVK2 H5I9U3 H5IQ47 H5J7P9 H5JPF3 H5K4V8 H5KKB7 H5KZS2 H5LCE3 H5LST2 H5M6X3 H5MLL3 H5MZZ4 H5NFD8 H5NW61 H5PAC5 H5PQQ1 H5Q565 H5QKP2 H5QZN5 H5RFH0 H6MI16 H8DE59 H9UXU2 I0VHT9 I0VW53 I0ZX47 I1B6N8 I2A181 I2I394 I2PHZ8 I2PIX5 I2QWA3 I2RF39 I2RT94 I2S7Z2 I2SV40 I2T5N0 I2TRE3 I2U3I0 I2UI68 I2V140 I2VK13 I2W2K0 I2WEL5 I2X038 I2X5K2 I2XV39 I2Y863 I2YPZ3 I2Z221 I2ZJ82 I2ZNL2 I3A8N3 I4J6I8 I4NIF6 I4NR78 I4PCL4 I4Q7J8 I4QGV6 I4QSF3 I4RFI2 I4RRA4 I4SLE7 I4SRW6 I4T7R1 I4TNR9 I4U2F4 I4U5U4 I4UVP8 I4UWR5 I5DEJ3 I5DIP5 I5DJM0 I5EUJ2 I5EV17 I5F3Q9 I5G436 I5GDF5 I5GMH4 I5HHH5 I5HUH3 I5HWD7 I5IWD7 I5JFC8 I5JJT8 I5JX07 I5KX09 I5KYZ6 I5L7M2 I5M7A7 I5MQJ8 I5MUU9 I5MZQ2 I5NY53 I5PJ02 I5PM48 I5Q3D7 I5QR59 I5QYF4 I5RP86 I5SEH0 I5SJ25 I5SSB7 I5TSZ1 I5TVY0 I5U8D3 I5UZZ1 I5VBU5 I5VNV0 I5WA45 I5WPE4 I5XE69 I5XKL1 I5XYI9 I5YKZ9 I5ZDK4 I5ZG52 I6B5J5 I6B7Z9 I6B9E3 I6CB07 I6CL79 I6D0Z6 I6DMD9 I6DZP4 I6E8L0 I6F2U5 I6FDH7 I6FJW1 I6FWL1 I6GHL6 J2FKR5 J2XHI3 J2Z1G8 J7QS21 J9ZG43 K0AHW1 K0BUF7 K0XB25 K2XM11 K2XVI1 K2Y758 K2YPV1 K2ZUR4 K3A3N1 K3B262 K3B2M5 K3B9F4 K3BKB6 K3C0G7 K3D3I5 K3DJI6 K3DSQ7 K3ECF4 K3EEQ4 K3EXR0 K3GBB6 K3GDW3 K3GTR4 K3H3K1 K3IDQ7 K3IGV9 K3IIS5 K3J8W8 K3JCT2 K3KBM7 K3KDX9 K3KHP3 K3KLS8 K3LY11 K3MIT2 K3MTL3 K3NAX3 K3NVR0 K3P8P2 K3PUV2 K3Q9X8 K3QIG2 K3REW7 K3RGN0 K3RIK8 K3SNX3 K3SSP7 K3SWF6 K3TAM0 K3UED2 K4UTK1 K4VG11 K4VPN7 K4VQR8 K4XBH6 K4XRT3 K4XTX1 K4XUQ0 K5BMF0 K5EXC2 K5F0M1 K5G065 K5GB06 K5GBW7 K5GE84 K5GFT2 K5GNB2 K5I6T7 K5IXF8 K5IZJ7 K5K4U0 L0XAT7 L0XEI8 L0XLI0 L0YJ31 L0YTY2 L0Z3I8 L1A3X1 L1A4U6 L1AGT0 L1BJA9 L1BLE3 L1BTZ6 L1CSL3 L1CYR7 L1DAW8 L1DX40 L1EGR6 L1EMJ5 L1FDZ7 L1FP24 L1G0V7 L1GQ60 L1GUA9 L1R867 L1RC46 L1V2Q8 L1VW39 L1VZY6 L1X716 L1XD19 L1XL61 L1YGE3 L1YPW8 L1YTU2 L1ZK57 L1ZN69 L1ZYX0 L2ALV8 L2AVJ1 L2BD23 L2BP35 L2C2L7 L2CMG5 L2D2R9 L2DCR7 L2DTI3 L2E765 L2U2J4 L2U5B0 L2UT68 L2VFC7 L2VMP1 L2VVD6 L2WF85 L2WHS9 L2X4U6 L2X832 L2XXX4 L2Y7M1 L2YPI4 L2Z0A4 L2ZDH2 L3A2D1 L3A5K8 L3ARP5 L3B0M2 L3BH89 L3C2L3 L3C7Z2 L3CQA8 L3D4X4 L3DGE8 L3DX59 L3E3P9 L3EQ38 L3F2C2 L3F9K5 L3FNB4 L3GAJ1 L3GJK2 L3H8H9 L3H962 L3HZ57 L3I768 L3IMU5 L3J1T2 L3JD79 L3JQ41 L3K6E2 L3KAX0 L3KXS7 L3LDJ9 L3M0A3 L3M4D2 L3MCS9 L3MYF0 L3N6G5 L3NNZ7 L3NVX6 L3PJ50 L3PXY0 L3QC12 L3QMC2 L3R6X2 L3RBH0 L3RZR4 L3S0Q9 L3SS53 L3STM7 L3TGD6 L3TKD9 L3UCF2 L3UL16 L3V1M0 L3V5W0 L3W0K2 L3WEC4 L3WKW4 L3WR13 L3XLQ6 L3XTX5 L3Y2K5 L3Y985 L3YXU9 L3YYE7 L3ZMV2 L3ZNK9 L4AB13 L4AMJ5 L4B5J0 L4BKX8 L4BN69 L4CRG5 L4CWA5 L4D0Q8 L4D303 L4DVC7 L4E089 L4EML7 L4EZA1 L4F988 L4FUR1 L4FXT7 L4G784 L4H6E3 L4HEE0 L4HG63 L4HQC5 L4I6E9 L4IM15 L4IYR2 L4JHL2 L4JV20 L4K667 L4KMP6 L4KYT0 L4L7A2 L4LJA9 L4LKD1 L4LXA9 L4MZE0 L4NF53 L4NGY4 L4NT90 L4P9D6 L4PRS5 L4Q038 L4QQV6 L4QXY5 L4R923 L4RVP2 L4S149 L4SC46 L4T637 L4TKC1 L4TLL1 L4TZU0 L4UL89 L4V4H9 L4V6T3 L4VLF5 L4W792 L4WI00 L4WKE9 L4XH45 L4XJY4 L4XWT8 L4YJK2 L4YVK9 L4ZMF4 L5A042 L5A9L9 L5AUW8 L5AZR4 L5BEL2 L5C174 L5C6F8 L5CDF8 L5D527 L5DD15 L5DJJ5 L5E977 L5EI68 L5ERV1 L5FIP4 L5FK85 L5FZ30 L5GP85 L5GY63 L5GYN9 L5HSR2 L5I262 L5I8N5 L5IYI4 L5JA78 L5VIS8 L8BZM3 L8C905 L8CMH0 L8YJ18 L8YMK8 L8ZBS6 L8ZY83 L8ZZM6 L9AAW3 L9B3S9 L9BDK7 L9BJF9 L9CMA3 L9CQM2 L9CRU0 L9DNL5 L9DVM1 L9ED67 L9EZS9 L9EZY0 L9FNA9 L9G605 L9GDY2 L9GRC8 L9HG99 L9HW04 L9I8E2 L9INP3 M2NL93 M2NP29 M2P7Q3 P63020 P63021 P63022 P63023 Q0SZQ1 Q0TC53 Q1R5M0 Q31VL8 Q32AM7 Q3YWL1
gi|91212889|ref|YP_542875.1| gi|26250015|ref|NP_756055.1| gi|74313917|ref|YP_312336.1| gi|386605992|ref|YP_006112292.1| gi|386641008|ref|YP_006107806.1| gi|157162891|ref|YP_001460209.1| gi|16131290|ref|NP_417873.1| gi|387614088|ref|YP_006117204.1| gi|387609106|ref|YP_006097962.1| gi|556553295|ref|YP_008723777.1| APC28291 ET33 gi|187731025|ref|YP_001882093.1| gi|15803918|ref|NP_289954.1| gi|386626202|ref|YP_006145930.1| gi|82778770|ref|YP_405119.1| gi|254795329|ref|YP_003080166.1| gi|157155730|ref|YP_001464872.1| 155864.Z4769 198214.SF3437 198215.S4328 199310.c4191 300267.SDY_3662 300268.SBO_3403 300269.SSON_3546 316385.ECDH10B_3589 316407.gntY 331111.EcE24377A_3889 331112.EcHS_A3611 344609.SbBS512_E3795 362663.ECP_3500 364106.UTI89_C3915 373384.SFV_3422 386585.ECs4256 405955.APECO1_3052 409438.ECSE_3681 413997.ECB_03266 439855.EcSMS35_3695 444450.ECH74115_4721 469008.ECBD_0331 481805.EcolC_0299 511145.b3414 544404.ECSP_4364 573235.ECO26_4502 574521.E2348C_3659 585034.ECIAI1_3558 585035.ECS88_3803 585054.EFER_3383 585055.EC55989_3822 585056.ECUMN_3873 585395.ECO103_4132 585396.ECO111_4223 585397.ECED1_4075 595496.BWG_3105 gi|544577950|ref|YP_008573474.1| gi|251786664|ref|YP_003000968.1| gi|384544982|ref|YP_005729046.1| gi|378711159|ref|YP_005276052.1| gi|386616198|ref|YP_006135864.1| gi|386711294|ref|YP_006175015.1| gi|253771757|ref|YP_003034588.1| gi|387623066|ref|YP_006130694.1| gi|260857521|ref|YP_003231412.1| gi|386636217|ref|YP_006155936.1| gi|24114681|ref|NP_709191.1| gi|215488695|ref|YP_002331126.1| gi|170082930|ref|YP_001732250.1| gi|387508782|ref|YP_006161038.1| gi|209396437|ref|YP_002272850.1| gi|443619477|ref|YP_007383333.1| gi|291284750|ref|YP_003501568.1| gi|544391866|ref|YP_008566555.1| gi|117625679|ref|YP_859002.1| gi|251786664|ref|YP_003000968.1| gi|82545771|ref|YP_409718.1| gi|110643647|ref|YP_671377.1| gi|387623066|ref|YP_006130694.1| gi|218697097|ref|YP_002404764.1| gi|387618701|ref|YP_006121723.1| gi|386711294|ref|YP_006175015.1| gi|254163342|ref|YP_003046450.1| gi|209920872|ref|YP_002294956.1| gi|30065301|ref|NP_839472.1| gi|560159558|ref|YP_008852273.1| gi|238902505|ref|YP_002928301.1| gi|386631297|ref|YP_006151017.1| gi|386706658|ref|YP_006170505.1| gi|407479979|ref|YP_006777128.1| gi|471334944|ref|YP_007558421.1| gi|383180580|ref|YP_005458585.1| gi|218707005|ref|YP_002414524.1| gi|218550672|ref|YP_002384463.1| gi|386601427|ref|YP_006102933.1| gi|386621055|ref|YP_006140635.1| gi|410480540|ref|YP_006768086.1| gi|170681204|ref|YP_001745662.1| gi|388479824|ref|YP_492018.1| gi|110807249|ref|YP_690769.1| gi|260846198|ref|YP_003223976.1| gi|218555963|ref|YP_002388876.1| gi|170018350|ref|YP_001723304.1| gi|218691690|ref|YP_002399902.1| gi|260870140|ref|YP_003236542.1| gi|378711159|ref|YP_005276052.1| gi|15833510|ref|NP_312283.1| gi|387884563|ref|YP_006314865.1| gi|218560472|ref|YP_002393385.1| gi|387831289|ref|YP_003351226.1| gi|407471365|ref|YP_006782192.1|

Jump to [ Top of page · Domain architecture · Domain assignment details ]