SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P63020 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P63020
Domain Number 1 Region: 95-184
Classification Level Classification E-value
Superfamily Fe-S cluster assembly (FSCA) domain-like 2.14e-25
Family NifU C-terminal domain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 1-97
Classification Level Classification E-value
Superfamily HesB-like domain 2.16e-20
Family HesB-like domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P63020
Sequence length 191
Comment (sp|P63020|NFUA_ECOLI) Fe/S biogenesis protein NfuA KW=Complete proteome; Reference proteome OX=83333 OS=Escherichia coli (strain K12). GN=b3414, OC=Enterobacteriaceae; Escherichia.
Sequence
MIRISDAAQAHFAKLLANQEEGTQIRVFVINPGTPNAECGVSYCPPDAVEATDTALKFDL
LTAYVDELSAPYLEDAEIDFVTDQLGSQLTLKAPNAKMRKVADDAPLMERVEYMLQSQIN
PQLAGHGGRVSLMEITEDGYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGVRDL
TEHQRGEHSYY
Download sequence
Identical sequences A0A017I706 A0A023Z4P2 A0A024KR47 A0A025CQ58 A0A028ANQ3 A0A029IIV0 A0A062Y6Y1 A0A064TBC5 A0A070UX00 A0A073HFH5 A0A073UPR5 A0A074HRK7 A0A080FPW0 A0A080IH72 A0A090NKQ0 A0A0A8UIR0 A0A0F6MIN0 A0A0H3EQL3 A0A0H3PXZ7 A0A0H9J741 A0A0S3N0V9 A0A127GQH7 A0A140N5A9 A0A142H7R9 A0A192CDB9 A0A1Q8M7W0 A0A1S6TGR9 A0A1W2MQI4 A0A1X3I0X9 A0A1X3IGD9 A0A1X3IUU6 A0A1X3JBE8 A0A1X3KF47 A0A1X3M6B0 A0A1Z3UYI8 A0A222QSJ3 A0A2D0NW51 A0A2H1BDC2 A0A2I8C6X2 A1AGT8 A7ZSU3 A8A5M2 B1EI66 B1IP51 B1LHL4 B1X760 B2U3M4 B5YTW5 B6I2X8 B7L4U4 B7LSB7 B7M1X0 B7MDP0 B7N147 B7NE19 B7UKB9 C3SPY2 C4ZVW3 C8TY30 C8UHP5 D2A9L8 D6IEU7 D7Y606 D8A6T3 D8E819 E2X8W3 E3XSV1 E7TBG4 E9XTA3 E9YVE1 F4NNC8 F4SQE5 F4V7B1 F5NA40 H4IH79 I2UI68 I2WEL5 I4T7R1 I6D0Z6 I6FDH7 J7QS21 K0XB25 K4XBH6 L2VFC7 L3C2L3 L3NVX6 L4IYR2 M9FNL5 P63020 P63021 P63022 P63023 Q0SZQ1 Q0TC53 Q1R5M0 Q31VL8 Q32AM7 Q3YWL1 R8XGI2 S0VQ37 S0WVN0 S0XH85 S1HTE2 S1NWH8 T9CLG2 T9S336 U9Y553 V0A8A4 V2UCY2 V6FU57 W1B9E2 W8ZXG6
gi|386605992|ref|YP_006112292.1| gi|110807249|ref|YP_690769.1| gi|387884563|ref|YP_006314865.1| gi|218560472|ref|YP_002393385.1| gi|157155730|ref|YP_001464872.1| APC28291 ET33 gi|387508782|ref|YP_006161038.1| gi|387623066|ref|YP_006130694.1| gi|91212889|ref|YP_542875.1| gi|24114681|ref|NP_709191.1| gi|407471365|ref|YP_006782192.1| gi|407479979|ref|YP_006777128.1| gi|30065301|ref|NP_839472.1| gi|387623066|ref|YP_006130694.1| gi|386636217|ref|YP_006155936.1| gi|544577950|ref|YP_008573474.1| gi|556553295|ref|YP_008723777.1| gi|471334944|ref|YP_007558421.1| gi|386631297|ref|YP_006151017.1| gi|15833510|ref|NP_312283.1| gi|251786664|ref|YP_003000968.1| gi|82778770|ref|YP_405119.1| gi|254795329|ref|YP_003080166.1| gi|378711159|ref|YP_005276052.1| gi|378711159|ref|YP_005276052.1| NP_312283.1.58667 NP_417873.1.90541 NP_709191.1.23235 WP_000619389.1.1000 WP_000619389.1.10001 WP_000619389.1.100014 WP_000619389.1.100044 WP_000619389.1.100052 WP_000619389.1.100063 WP_000619389.1.100066 WP_000619389.1.100073 WP_000619389.1.100085 WP_000619389.1.10010 WP_000619389.1.100111 WP_000619389.1.100116 WP_000619389.1.100135 WP_000619389.1.100138 WP_000619389.1.100159 WP_000619389.1.100185 WP_000619389.1.100194 WP_000619389.1.100220 WP_000619389.1.100227 WP_000619389.1.100251 WP_000619389.1.100252 WP_000619389.1.100281 WP_000619389.1.100283 WP_000619389.1.100285 WP_000619389.1.100299 WP_000619389.1.100302 WP_000619389.1.100304 WP_000619389.1.100306 WP_000619389.1.100315 WP_000619389.1.10034 WP_000619389.1.100346 WP_000619389.1.100389 WP_000619389.1.100425 WP_000619389.1.100441 WP_000619389.1.100444 WP_000619389.1.100447 WP_000619389.1.100448 WP_000619389.1.100451 WP_000619389.1.100474 WP_000619389.1.10048 WP_000619389.1.100487 WP_000619389.1.100496 WP_000619389.1.100499 WP_000619389.1.100508 WP_000619389.1.10051 WP_000619389.1.100531 WP_000619389.1.100543 WP_000619389.1.100554 WP_000619389.1.100571 WP_000619389.1.100573 WP_000619389.1.100614 WP_000619389.1.100667 WP_000619389.1.10067 WP_000619389.1.10068 WP_000619389.1.100685 WP_000619389.1.100688 WP_000619389.1.100689 WP_000619389.1.100718 WP_000619389.1.100725 WP_000619389.1.100735 WP_000619389.1.100738 WP_000619389.1.100752 WP_000619389.1.100753 WP_000619389.1.100758 WP_000619389.1.100778 WP_000619389.1.100796 WP_000619389.1.10080 WP_000619389.1.100803 WP_000619389.1.100824 WP_000619389.1.100836 WP_000619389.1.100851 WP_000619389.1.100852 WP_000619389.1.10086 WP_000619389.1.100867 WP_000619389.1.100868 WP_000619389.1.100898 WP_000619389.1.100916 WP_000619389.1.100925 WP_000619389.1.100928 WP_000619389.1.100933 WP_000619389.1.10094 WP_000619389.1.100950 WP_000619389.1.100966 WP_000619389.1.100990 WP_000619389.1.10100 WP_000619389.1.101033 WP_000619389.1.101052 WP_000619389.1.101087 WP_000619389.1.101096 WP_000619389.1.1011 WP_000619389.1.101102 WP_000619389.1.101105 WP_000619389.1.101110 WP_000619389.1.101121 WP_000619389.1.101148 WP_000619389.1.101152 WP_000619389.1.101157 WP_000619389.1.101158 WP_000619389.1.101166 WP_000619389.1.101175 WP_000619389.1.101186 WP_000619389.1.101206 WP_000619389.1.101214 WP_000619389.1.101216 WP_000619389.1.101255 WP_000619389.1.101257 WP_000619389.1.10126 WP_000619389.1.101282 WP_000619389.1.101289 WP_000619389.1.10131 WP_000619389.1.101313 WP_000619389.1.101359 WP_000619389.1.10138 WP_000619389.1.101387 WP_000619389.1.101399 WP_000619389.1.101418 WP_000619389.1.101423 WP_000619389.1.101429 WP_000619389.1.101430 WP_000619389.1.101436 WP_000619389.1.101439 WP_000619389.1.101445 WP_000619389.1.101468 WP_000619389.1.101486 WP_000619389.1.101518 WP_000619389.1.101522 WP_000619389.1.10154 WP_000619389.1.101545 WP_000619389.1.101583 WP_000619389.1.101586 WP_000619389.1.101594 WP_000619389.1.101628 WP_000619389.1.101630 WP_000619389.1.101651 WP_000619389.1.101653 WP_000619389.1.101654 WP_000619389.1.101667 WP_000619389.1.101668 WP_000619389.1.101686 WP_000619389.1.101693 WP_000619389.1.101694 WP_000619389.1.101700 WP_000619389.1.101727 WP_000619389.1.10173 WP_000619389.1.101737 WP_000619389.1.101747 WP_000619389.1.101769 WP_000619389.1.101777 WP_000619389.1.101786 WP_000619389.1.10181 WP_000619389.1.101822 WP_000619389.1.10184 WP_000619389.1.101840 WP_000619389.1.101845 WP_000619389.1.101855 WP_000619389.1.101865 WP_000619389.1.10187 WP_000619389.1.10188 WP_000619389.1.101887 WP_000619389.1.101889 WP_000619389.1.10190 WP_000619389.1.101900 WP_000619389.1.101908 WP_000619389.1.101913 WP_000619389.1.101926 WP_000619389.1.101932 WP_000619389.1.101935 WP_000619389.1.101937 WP_000619389.1.101940 WP_000619389.1.101942 WP_000619389.1.101947 WP_000619389.1.101948 WP_000619389.1.101952 WP_000619389.1.101962 WP_000619389.1.101964 WP_000619389.1.101969 WP_000619389.1.101977 WP_000619389.1.101984 WP_000619389.1.101987 WP_000619389.1.102021 WP_000619389.1.102036 WP_000619389.1.10206 WP_000619389.1.102069 WP_000619389.1.102076 WP_000619389.1.102093 WP_000619389.1.102094 WP_000619389.1.102104 WP_000619389.1.102106 WP_000619389.1.102122 WP_000619389.1.102139 WP_000619389.1.102144 WP_000619389.1.10222 WP_000619389.1.10226 WP_000619389.1.10233 WP_000619389.1.10235 WP_000619389.1.10252 WP_000619389.1.10273 WP_000619389.1.10304 WP_000619389.1.10326 WP_000619389.1.10329 WP_000619389.1.10335 WP_000619389.1.10348 WP_000619389.1.10352 WP_000619389.1.10361 WP_000619389.1.10379 WP_000619389.1.10381 WP_000619389.1.1040 WP_000619389.1.10400 WP_000619389.1.10417 WP_000619389.1.10461 WP_000619389.1.10476 WP_000619389.1.10491 WP_000619389.1.10492 WP_000619389.1.10496 WP_000619389.1.10508 WP_000619389.1.10524 WP_000619389.1.10525 WP_000619389.1.10538 WP_000619389.1.10569 WP_000619389.1.10573 WP_000619389.1.10576 WP_000619389.1.10579 WP_000619389.1.1058 WP_000619389.1.10605 WP_000619389.1.10607 WP_000619389.1.10628 WP_000619389.1.10651 WP_000619389.1.10673 WP_000619389.1.10697 WP_000619389.1.10705 WP_000619389.1.1071 WP_000619389.1.10715 WP_000619389.1.10729 WP_000619389.1.1073 WP_000619389.1.1074 WP_000619389.1.10744 WP_000619389.1.10748 WP_000619389.1.10761 WP_000619389.1.10763 WP_000619389.1.10771 WP_000619389.1.10786 WP_000619389.1.10787 WP_000619389.1.10798 WP_000619389.1.10809 WP_000619389.1.10814 WP_000619389.1.10824 WP_000619389.1.10833 WP_000619389.1.10842 WP_000619389.1.10849 WP_000619389.1.10862 WP_000619389.1.10869 WP_000619389.1.10922 WP_000619389.1.10940 WP_000619389.1.10970 WP_000619389.1.10988 WP_000619389.1.10989 WP_000619389.1.10994 WP_000619389.1.10995 WP_000619389.1.11006 WP_000619389.1.11032 WP_000619389.1.11047 WP_000619389.1.11052 WP_000619389.1.11057 WP_000619389.1.11068 WP_000619389.1.11071 WP_000619389.1.11091 WP_000619389.1.1111 WP_000619389.1.11113 WP_000619389.1.11118 WP_000619389.1.11121 WP_000619389.1.1113 WP_000619389.1.11133 WP_000619389.1.112 WP_000619389.1.11217 WP_000619389.1.1122 WP_000619389.1.11240 WP_000619389.1.11241 WP_000619389.1.11250 WP_000619389.1.11251 WP_000619389.1.11265 WP_000619389.1.11272 WP_000619389.1.11285 WP_000619389.1.11296 WP_000619389.1.11301 WP_000619389.1.11315 WP_000619389.1.11323 WP_000619389.1.11399 WP_000619389.1.11408 WP_000619389.1.1141 WP_000619389.1.11418 WP_000619389.1.11420 WP_000619389.1.11436 WP_000619389.1.11437 WP_000619389.1.11440 WP_000619389.1.11452 WP_000619389.1.11467 WP_000619389.1.11499 WP_000619389.1.11519 WP_000619389.1.11524 WP_000619389.1.11531 WP_000619389.1.11542 WP_000619389.1.11575 WP_000619389.1.11578 WP_000619389.1.11595 WP_000619389.1.11607 WP_000619389.1.11608 WP_000619389.1.11612 WP_000619389.1.11616 WP_000619389.1.11645 WP_000619389.1.11671 WP_000619389.1.11673 WP_000619389.1.1168 WP_000619389.1.11690 WP_000619389.1.11699 WP_000619389.1.11748 WP_000619389.1.11759 WP_000619389.1.1176 WP_000619389.1.11762 WP_000619389.1.11801 WP_000619389.1.11803 WP_000619389.1.11844 WP_000619389.1.1186 WP_000619389.1.11912 WP_000619389.1.11948 WP_000619389.1.11949 WP_000619389.1.11955 WP_000619389.1.11956 WP_000619389.1.1196 WP_000619389.1.11981 WP_000619389.1.11982 WP_000619389.1.11985 WP_000619389.1.12000 WP_000619389.1.12009 WP_000619389.1.12010 WP_000619389.1.12030 WP_000619389.1.12036 WP_000619389.1.12050 WP_000619389.1.12051 WP_000619389.1.12060 WP_000619389.1.12076 WP_000619389.1.12088 WP_000619389.1.12095 WP_000619389.1.12111 WP_000619389.1.12112 WP_000619389.1.12115 WP_000619389.1.1212 WP_000619389.1.12151 WP_000619389.1.12157 WP_000619389.1.12174 WP_000619389.1.1218 WP_000619389.1.12204 WP_000619389.1.12230 WP_000619389.1.12259 WP_000619389.1.12268 WP_000619389.1.12279 WP_000619389.1.12292 WP_000619389.1.12295 WP_000619389.1.12305 WP_000619389.1.12319 WP_000619389.1.12320 WP_000619389.1.12342 WP_000619389.1.12344 WP_000619389.1.12352 WP_000619389.1.12415 WP_000619389.1.1242 WP_000619389.1.12426 WP_000619389.1.12458 WP_000619389.1.12459 WP_000619389.1.12478 WP_000619389.1.12542 WP_000619389.1.12552 WP_000619389.1.12558 WP_000619389.1.12566 WP_000619389.1.12574 WP_000619389.1.12582 WP_000619389.1.12623 WP_000619389.1.12645 WP_000619389.1.12675 WP_000619389.1.12679 WP_000619389.1.12680 WP_000619389.1.12693 WP_000619389.1.12697 WP_000619389.1.127 WP_000619389.1.12709 WP_000619389.1.12717 WP_000619389.1.12743 WP_000619389.1.12749 WP_000619389.1.1275 WP_000619389.1.12756 WP_000619389.1.12761 WP_000619389.1.12762 WP_000619389.1.12763 WP_000619389.1.12766 WP_000619389.1.12775 WP_000619389.1.1278 WP_000619389.1.12781 WP_000619389.1.1280 WP_000619389.1.12826 WP_000619389.1.12830 WP_000619389.1.12831 WP_000619389.1.12876 WP_000619389.1.12893 WP_000619389.1.12911 WP_000619389.1.12914 WP_000619389.1.12915 WP_000619389.1.12917 WP_000619389.1.12944 WP_000619389.1.1295 WP_000619389.1.12956 WP_000619389.1.12965 WP_000619389.1.12976 WP_000619389.1.12979 WP_000619389.1.12987 WP_000619389.1.12991 WP_000619389.1.13002 WP_000619389.1.13015 WP_000619389.1.13031 WP_000619389.1.13060 WP_000619389.1.13074 WP_000619389.1.1308 WP_000619389.1.13117 WP_000619389.1.1312 WP_000619389.1.13136 WP_000619389.1.1314 WP_000619389.1.13144 WP_000619389.1.1315 WP_000619389.1.13157 WP_000619389.1.13162 WP_000619389.1.13176 WP_000619389.1.13181 WP_000619389.1.13205 WP_000619389.1.13217 WP_000619389.1.13222 WP_000619389.1.13223 WP_000619389.1.1323 WP_000619389.1.13239 WP_000619389.1.13252 WP_000619389.1.13258 WP_000619389.1.13271 WP_000619389.1.13272 WP_000619389.1.13278 WP_000619389.1.13281 WP_000619389.1.13290 WP_000619389.1.13295 WP_000619389.1.13301 WP_000619389.1.13332 WP_000619389.1.13333 WP_000619389.1.13346 WP_000619389.1.13348 WP_000619389.1.1335 WP_000619389.1.13383 WP_000619389.1.13393 WP_000619389.1.13409 WP_000619389.1.13411 WP_000619389.1.1343 WP_000619389.1.13430 WP_000619389.1.13437 WP_000619389.1.13442 WP_000619389.1.1345 WP_000619389.1.13451 WP_000619389.1.13469 WP_000619389.1.13473 WP_000619389.1.13481 WP_000619389.1.13492 WP_000619389.1.13495 WP_000619389.1.13525 WP_000619389.1.13566 WP_000619389.1.13585 WP_000619389.1.13589 WP_000619389.1.13600 WP_000619389.1.13601 WP_000619389.1.13618 WP_000619389.1.13624 WP_000619389.1.13626 WP_000619389.1.13644 WP_000619389.1.13656 WP_000619389.1.13662 WP_000619389.1.13664 WP_000619389.1.13672 WP_000619389.1.13740 WP_000619389.1.13778 WP_000619389.1.13791 WP_000619389.1.13798 WP_000619389.1.13824 WP_000619389.1.13867 WP_000619389.1.13877 WP_000619389.1.13881 WP_000619389.1.13891 WP_000619389.1.13924 WP_000619389.1.13934 WP_000619389.1.13936 WP_000619389.1.13939 WP_000619389.1.13944 WP_000619389.1.13949 WP_000619389.1.13974 WP_000619389.1.13979 WP_000619389.1.13981 WP_000619389.1.14023 WP_000619389.1.14030 WP_000619389.1.14042 WP_000619389.1.14058 WP_000619389.1.14062 WP_000619389.1.14070 WP_000619389.1.14094 WP_000619389.1.14110 WP_000619389.1.14127 WP_000619389.1.14129 WP_000619389.1.14144 WP_000619389.1.14154 WP_000619389.1.14164 WP_000619389.1.1419 WP_000619389.1.14199 WP_000619389.1.142 WP_000619389.1.14245 WP_000619389.1.14253 WP_000619389.1.14277 WP_000619389.1.14292 WP_000619389.1.14299 WP_000619389.1.14304 WP_000619389.1.14322 WP_000619389.1.14331 WP_000619389.1.14346 WP_000619389.1.14371 WP_000619389.1.1438 WP_000619389.1.14389 WP_000619389.1.1439 WP_000619389.1.14398 WP_000619389.1.14417 WP_000619389.1.14432 WP_000619389.1.14445 WP_000619389.1.14451 WP_000619389.1.14453 WP_000619389.1.14468 WP_000619389.1.14493 WP_000619389.1.14499 WP_000619389.1.14501 WP_000619389.1.14506 WP_000619389.1.14508 WP_000619389.1.14509 WP_000619389.1.14536 WP_000619389.1.14538 WP_000619389.1.14581 WP_000619389.1.14582 WP_000619389.1.14600 WP_000619389.1.14601 WP_000619389.1.14605 WP_000619389.1.14607 WP_000619389.1.1461 WP_000619389.1.14616 WP_000619389.1.14648 WP_000619389.1.14661 WP_000619389.1.14672 WP_000619389.1.14678 WP_000619389.1.14687 WP_000619389.1.14693 WP_000619389.1.1470 WP_000619389.1.14711 WP_000619389.1.14712 WP_000619389.1.14746 WP_000619389.1.14748 WP_000619389.1.14749 WP_000619389.1.14811 WP_000619389.1.14833 WP_000619389.1.1486 WP_000619389.1.14861 WP_000619389.1.14871 WP_000619389.1.14879 WP_000619389.1.14914 WP_000619389.1.14934 WP_000619389.1.14935 WP_000619389.1.14946 WP_000619389.1.14956 WP_000619389.1.14958 WP_000619389.1.14963 WP_000619389.1.14965 WP_000619389.1.14977 WP_000619389.1.14992 WP_000619389.1.14993 WP_000619389.1.15007 WP_000619389.1.15020 WP_000619389.1.15041 WP_000619389.1.15068 WP_000619389.1.1508 WP_000619389.1.15087 WP_000619389.1.15090 WP_000619389.1.1510 WP_000619389.1.15117 WP_000619389.1.1512 WP_000619389.1.15121 WP_000619389.1.15138 WP_000619389.1.15148 WP_000619389.1.15177 WP_000619389.1.15191 WP_000619389.1.15193 WP_000619389.1.15207 WP_000619389.1.15221 WP_000619389.1.1524 WP_000619389.1.15245 WP_000619389.1.15252 WP_000619389.1.15259 WP_000619389.1.15270 WP_000619389.1.15274 WP_000619389.1.15277 WP_000619389.1.15282 WP_000619389.1.15287 WP_000619389.1.15290 WP_000619389.1.153 WP_000619389.1.15300 WP_000619389.1.15304 WP_000619389.1.15332 WP_000619389.1.15335 WP_000619389.1.15347 WP_000619389.1.15356 WP_000619389.1.15377 WP_000619389.1.15416 WP_000619389.1.15420 WP_000619389.1.1543 WP_000619389.1.15444 WP_000619389.1.15453 WP_000619389.1.15464 WP_000619389.1.15469 WP_000619389.1.15496 WP_000619389.1.1550 WP_000619389.1.15503 WP_000619389.1.15521 WP_000619389.1.15527 WP_000619389.1.15528 WP_000619389.1.15538 WP_000619389.1.15565 WP_000619389.1.15576 WP_000619389.1.15583 WP_000619389.1.1559 WP_000619389.1.15593 WP_000619389.1.15600 WP_000619389.1.1561 WP_000619389.1.15620 WP_000619389.1.15624 WP_000619389.1.15626 WP_000619389.1.15645 WP_000619389.1.15654 WP_000619389.1.15702 WP_000619389.1.15707 WP_000619389.1.15731 WP_000619389.1.15740 WP_000619389.1.15747 WP_000619389.1.15752 WP_000619389.1.15762 WP_000619389.1.15767 WP_000619389.1.15768 WP_000619389.1.15771 WP_000619389.1.15791 WP_000619389.1.1580 WP_000619389.1.15809 WP_000619389.1.1582 WP_000619389.1.15855 WP_000619389.1.15857 WP_000619389.1.15863 WP_000619389.1.15869 WP_000619389.1.1588 WP_000619389.1.15894 WP_000619389.1.15906 WP_000619389.1.15916 WP_000619389.1.15945 WP_000619389.1.15949 WP_000619389.1.15951 WP_000619389.1.15983 WP_000619389.1.15984 WP_000619389.1.15990 WP_000619389.1.16010 WP_000619389.1.16014 WP_000619389.1.16015 WP_000619389.1.16034 WP_000619389.1.1604 WP_000619389.1.16042 WP_000619389.1.16067 WP_000619389.1.16075 WP_000619389.1.16086 WP_000619389.1.16087 WP_000619389.1.1609 WP_000619389.1.16102 WP_000619389.1.16111 WP_000619389.1.16117 WP_000619389.1.16131 WP_000619389.1.16133 WP_000619389.1.16154 WP_000619389.1.16171 WP_000619389.1.16175 WP_000619389.1.16179 WP_000619389.1.16183 WP_000619389.1.16188 WP_000619389.1.16194 WP_000619389.1.1621 WP_000619389.1.1622 WP_000619389.1.16222 WP_000619389.1.16270 WP_000619389.1.16272 WP_000619389.1.16294 WP_000619389.1.163 WP_000619389.1.16303 WP_000619389.1.16322 WP_000619389.1.1634 WP_000619389.1.16387 WP_000619389.1.16388 WP_000619389.1.16396 WP_000619389.1.1640 WP_000619389.1.16435 WP_000619389.1.16463 WP_000619389.1.16481 WP_000619389.1.16482 WP_000619389.1.16517 WP_000619389.1.16532 WP_000619389.1.16539 WP_000619389.1.16541 WP_000619389.1.1655 WP_000619389.1.16577 WP_000619389.1.16592 WP_000619389.1.16604 WP_000619389.1.16608 WP_000619389.1.16640 WP_000619389.1.16648 WP_000619389.1.16667 WP_000619389.1.16669 WP_000619389.1.16682 WP_000619389.1.16685 WP_000619389.1.16700 WP_000619389.1.16705 WP_000619389.1.16715 WP_000619389.1.16721 WP_000619389.1.1673 WP_000619389.1.16745 WP_000619389.1.16752 WP_000619389.1.16766 WP_000619389.1.16780 WP_000619389.1.16798 WP_000619389.1.16799 WP_000619389.1.16805 WP_000619389.1.16807 WP_000619389.1.16818 WP_000619389.1.16843 WP_000619389.1.16845 WP_000619389.1.16861 WP_000619389.1.16862 WP_000619389.1.16894 WP_000619389.1.16927 WP_000619389.1.16970 WP_000619389.1.16979 WP_000619389.1.16992 WP_000619389.1.17014 WP_000619389.1.17017 WP_000619389.1.17018 WP_000619389.1.17028 WP_000619389.1.17042 WP_000619389.1.17061 WP_000619389.1.17084 WP_000619389.1.17085 WP_000619389.1.17087 WP_000619389.1.17089 WP_000619389.1.1710 WP_000619389.1.17101 WP_000619389.1.17102 WP_000619389.1.17109 WP_000619389.1.17111 WP_000619389.1.17114 WP_000619389.1.17119 WP_000619389.1.17123 WP_000619389.1.17150 WP_000619389.1.17153 WP_000619389.1.17170 WP_000619389.1.17172 WP_000619389.1.17182 WP_000619389.1.17186 WP_000619389.1.17187 WP_000619389.1.17205 WP_000619389.1.17206 WP_000619389.1.17216 WP_000619389.1.17230 WP_000619389.1.17241 WP_000619389.1.17242 WP_000619389.1.1726 WP_000619389.1.17267 WP_000619389.1.17282 WP_000619389.1.17290 WP_000619389.1.17297 WP_000619389.1.17300 WP_000619389.1.17301 WP_000619389.1.1731 WP_000619389.1.17325 WP_000619389.1.17333 WP_000619389.1.17356 WP_000619389.1.17360 WP_000619389.1.17373 WP_000619389.1.17386 WP_000619389.1.17387 WP_000619389.1.17389 WP_000619389.1.17392 WP_000619389.1.17403 WP_000619389.1.17410 WP_000619389.1.17415 WP_000619389.1.17417 WP_000619389.1.17432 WP_000619389.1.17441 WP_000619389.1.17461 WP_000619389.1.17464 WP_000619389.1.17496 WP_000619389.1.17515 WP_000619389.1.17534 WP_000619389.1.1754 WP_000619389.1.1755 WP_000619389.1.17550 WP_000619389.1.17568 WP_000619389.1.17570 WP_000619389.1.17577 WP_000619389.1.17584 WP_000619389.1.17595 WP_000619389.1.17623 WP_000619389.1.1763 WP_000619389.1.17637 WP_000619389.1.1766 WP_000619389.1.17680 WP_000619389.1.1769 WP_000619389.1.17701 WP_000619389.1.17711 WP_000619389.1.1772 WP_000619389.1.17734 WP_000619389.1.17757 WP_000619389.1.17765 WP_000619389.1.17766 WP_000619389.1.17769 WP_000619389.1.1778 WP_000619389.1.17802 WP_000619389.1.17829 WP_000619389.1.17831 WP_000619389.1.17836 WP_000619389.1.17849 WP_000619389.1.17889 WP_000619389.1.17904 WP_000619389.1.17920 WP_000619389.1.17925 WP_000619389.1.17937 WP_000619389.1.17952 WP_000619389.1.17961 WP_000619389.1.17963 WP_000619389.1.17984 WP_000619389.1.18000 WP_000619389.1.18006 WP_000619389.1.1802 WP_000619389.1.18024 WP_000619389.1.18050 WP_000619389.1.18064 WP_000619389.1.18094 WP_000619389.1.18112 WP_000619389.1.18118 WP_000619389.1.18133 WP_000619389.1.18134 WP_000619389.1.18136 WP_000619389.1.18164 WP_000619389.1.18175 WP_000619389.1.1821 WP_000619389.1.18225 WP_000619389.1.18226 WP_000619389.1.18229 WP_000619389.1.18275 WP_000619389.1.18311 WP_000619389.1.18316 WP_000619389.1.18326 WP_000619389.1.18329 WP_000619389.1.18337 WP_000619389.1.18338 WP_000619389.1.1834 WP_000619389.1.18340 WP_000619389.1.18348 WP_000619389.1.18354 WP_000619389.1.18381 WP_000619389.1.18383 WP_000619389.1.18394 WP_000619389.1.18402 WP_000619389.1.18410 WP_000619389.1.18420 WP_000619389.1.18428 WP_000619389.1.18436 WP_000619389.1.18438 WP_000619389.1.1844 WP_000619389.1.18458 WP_000619389.1.18461 WP_000619389.1.18472 WP_000619389.1.18482 WP_000619389.1.18511 WP_000619389.1.18519 WP_000619389.1.18530 WP_000619389.1.18550 WP_000619389.1.18556 WP_000619389.1.18581 WP_000619389.1.18583 WP_000619389.1.18588 WP_000619389.1.1861 WP_000619389.1.18617 WP_000619389.1.1862 WP_000619389.1.18628 WP_000619389.1.18649 WP_000619389.1.18650 WP_000619389.1.18651 WP_000619389.1.18655 WP_000619389.1.1866 WP_000619389.1.18666 WP_000619389.1.1867 WP_000619389.1.18675 WP_000619389.1.18699 WP_000619389.1.18714 WP_000619389.1.18725 WP_000619389.1.18726 WP_000619389.1.1873 WP_000619389.1.18734 WP_000619389.1.18794 WP_000619389.1.188 WP_000619389.1.18801 WP_000619389.1.18802 WP_000619389.1.18806 WP_000619389.1.1881 WP_000619389.1.18828 WP_000619389.1.18837 WP_000619389.1.18843 WP_000619389.1.18858 WP_000619389.1.18861 WP_000619389.1.18874 WP_000619389.1.18876 WP_000619389.1.18899 WP_000619389.1.18908 WP_000619389.1.18923 WP_000619389.1.18929 WP_000619389.1.18934 WP_000619389.1.18936 WP_000619389.1.1896 WP_000619389.1.18962 WP_000619389.1.18966 WP_000619389.1.18983 WP_000619389.1.18995 WP_000619389.1.19024 WP_000619389.1.1903 WP_000619389.1.19036 WP_000619389.1.19039 WP_000619389.1.1906 WP_000619389.1.19075 WP_000619389.1.1909 WP_000619389.1.191 WP_000619389.1.19100 WP_000619389.1.19113 WP_000619389.1.19114 WP_000619389.1.19122 WP_000619389.1.19129 WP_000619389.1.19135 WP_000619389.1.19140 WP_000619389.1.19146 WP_000619389.1.19147 WP_000619389.1.19148 WP_000619389.1.1915 WP_000619389.1.19150 WP_000619389.1.19153 WP_000619389.1.19171 WP_000619389.1.19194 WP_000619389.1.19205 WP_000619389.1.19245 WP_000619389.1.1925 WP_000619389.1.19276 WP_000619389.1.19277 WP_000619389.1.19297 WP_000619389.1.193 WP_000619389.1.19312 WP_000619389.1.19313 WP_000619389.1.19314 WP_000619389.1.19315 WP_000619389.1.19332 WP_000619389.1.19338 WP_000619389.1.19347 WP_000619389.1.19350 WP_000619389.1.19361 WP_000619389.1.19374 WP_000619389.1.19379 WP_000619389.1.19389 WP_000619389.1.19397 WP_000619389.1.19419 WP_000619389.1.19424 WP_000619389.1.19441 WP_000619389.1.19448 WP_000619389.1.19453 WP_000619389.1.19465 WP_000619389.1.19478 WP_000619389.1.19487 WP_000619389.1.19492 WP_000619389.1.19494 WP_000619389.1.1952 WP_000619389.1.19534 WP_000619389.1.19544 WP_000619389.1.19545 WP_000619389.1.19547 WP_000619389.1.19557 WP_000619389.1.19581 WP_000619389.1.19583 WP_000619389.1.19593 WP_000619389.1.19602 WP_000619389.1.19612 WP_000619389.1.1963 WP_000619389.1.19644 WP_000619389.1.19649 WP_000619389.1.19651 WP_000619389.1.19654 WP_000619389.1.19655 WP_000619389.1.19661 WP_000619389.1.19684 WP_000619389.1.19691 WP_000619389.1.19758 WP_000619389.1.19760 WP_000619389.1.19761 WP_000619389.1.19778 WP_000619389.1.19795 WP_000619389.1.1982 WP_000619389.1.19830 WP_000619389.1.19838 WP_000619389.1.19840 WP_000619389.1.19845 WP_000619389.1.19847 WP_000619389.1.19861 WP_000619389.1.1987 WP_000619389.1.19873 WP_000619389.1.19878 WP_000619389.1.19889 WP_000619389.1.19940 WP_000619389.1.19945 WP_000619389.1.19957 WP_000619389.1.19972 WP_000619389.1.19994 WP_000619389.1.20025 WP_000619389.1.2005 WP_000619389.1.20096 WP_000619389.1.20114 WP_000619389.1.20115 WP_000619389.1.20129 WP_000619389.1.20133 WP_000619389.1.20136 WP_000619389.1.2015 WP_000619389.1.20151 WP_000619389.1.20157 WP_000619389.1.20159 WP_000619389.1.20164 WP_000619389.1.20166 WP_000619389.1.20170 WP_000619389.1.20178 WP_000619389.1.20183 WP_000619389.1.20192 WP_000619389.1.20215 WP_000619389.1.2022 WP_000619389.1.20224 WP_000619389.1.20230 WP_000619389.1.20238 WP_000619389.1.20251 WP_000619389.1.20264 WP_000619389.1.2027 WP_000619389.1.20277 WP_000619389.1.20289 WP_000619389.1.20290 WP_000619389.1.20308 WP_000619389.1.20318 WP_000619389.1.20325 WP_000619389.1.20331 WP_000619389.1.20334 WP_000619389.1.20370 WP_000619389.1.20388 WP_000619389.1.20442 WP_000619389.1.20445 WP_000619389.1.20449 WP_000619389.1.20452 WP_000619389.1.20480 WP_000619389.1.20483 WP_000619389.1.20484 WP_000619389.1.20493 WP_000619389.1.20506 WP_000619389.1.20519 WP_000619389.1.20536 WP_000619389.1.20546 WP_000619389.1.20549 WP_000619389.1.20565 WP_000619389.1.20575 WP_000619389.1.20594 WP_000619389.1.20596 WP_000619389.1.20609 WP_000619389.1.2063 WP_000619389.1.20630 WP_000619389.1.20636 WP_000619389.1.20638 WP_000619389.1.20640 WP_000619389.1.20662 WP_000619389.1.20668 WP_000619389.1.20691 WP_000619389.1.20709 WP_000619389.1.20724 WP_000619389.1.20730 WP_000619389.1.20737 WP_000619389.1.20741 WP_000619389.1.20745 WP_000619389.1.2075 WP_000619389.1.20761 WP_000619389.1.20765 WP_000619389.1.20784 WP_000619389.1.20785 WP_000619389.1.20803 WP_000619389.1.20813 WP_000619389.1.20818 WP_000619389.1.20824 WP_000619389.1.20831 WP_000619389.1.20841 WP_000619389.1.20848 WP_000619389.1.20863 WP_000619389.1.2089 WP_000619389.1.20893 WP_000619389.1.20907 WP_000619389.1.2092 WP_000619389.1.2093 WP_000619389.1.20933 WP_000619389.1.2094 WP_000619389.1.20941 WP_000619389.1.20943 WP_000619389.1.20950 WP_000619389.1.20958 WP_000619389.1.20962 WP_000619389.1.20982 WP_000619389.1.20989 WP_000619389.1.2100 WP_000619389.1.21017 WP_000619389.1.21020 WP_000619389.1.21022 WP_000619389.1.21024 WP_000619389.1.21029 WP_000619389.1.21033 WP_000619389.1.21041 WP_000619389.1.21057 WP_000619389.1.21059 WP_000619389.1.21104 WP_000619389.1.21122 WP_000619389.1.21129 WP_000619389.1.2113 WP_000619389.1.21131 WP_000619389.1.21137 WP_000619389.1.21152 WP_000619389.1.21171 WP_000619389.1.21197 WP_000619389.1.21236 WP_000619389.1.21248 WP_000619389.1.21251 WP_000619389.1.21255 WP_000619389.1.21266 WP_000619389.1.21277 WP_000619389.1.21305 WP_000619389.1.21320 WP_000619389.1.21336 WP_000619389.1.21378 WP_000619389.1.2142 WP_000619389.1.21441 WP_000619389.1.21450 WP_000619389.1.21455 WP_000619389.1.21470 WP_000619389.1.21508 WP_000619389.1.21519 WP_000619389.1.21526 WP_000619389.1.2153 WP_000619389.1.21537 WP_000619389.1.2156 WP_000619389.1.21573 WP_000619389.1.21578 WP_000619389.1.21596 WP_000619389.1.21614 WP_000619389.1.21628 WP_000619389.1.21634 WP_000619389.1.21637 WP_000619389.1.2164 WP_000619389.1.21652 WP_000619389.1.21656 WP_000619389.1.21661 WP_000619389.1.21666 WP_000619389.1.21667 WP_000619389.1.21668 WP_000619389.1.21673 WP_000619389.1.21696 WP_000619389.1.21714 WP_000619389.1.21727 WP_000619389.1.21729 WP_000619389.1.21732 WP_000619389.1.21733 WP_000619389.1.21756 WP_000619389.1.21758 WP_000619389.1.21762 WP_000619389.1.21771 WP_000619389.1.21773 WP_000619389.1.21811 WP_000619389.1.21812 WP_000619389.1.21823 WP_000619389.1.21887 WP_000619389.1.21895 WP_000619389.1.21899 WP_000619389.1.21915 WP_000619389.1.21948 WP_000619389.1.21962 WP_000619389.1.2198 WP_000619389.1.21986 WP_000619389.1.21992 WP_000619389.1.22021 WP_000619389.1.22042 WP_000619389.1.22060 WP_000619389.1.22088 WP_000619389.1.22098 WP_000619389.1.22113 WP_000619389.1.22138 WP_000619389.1.22161 WP_000619389.1.2218 WP_000619389.1.22182 WP_000619389.1.22189 WP_000619389.1.22195 WP_000619389.1.22203 WP_000619389.1.22204 WP_000619389.1.22251 WP_000619389.1.22268 WP_000619389.1.22269 WP_000619389.1.22272 WP_000619389.1.22280 WP_000619389.1.22291 WP_000619389.1.22293 WP_000619389.1.22295 WP_000619389.1.22304 WP_000619389.1.22314 WP_000619389.1.2232 WP_000619389.1.22325 WP_000619389.1.22328 WP_000619389.1.22350 WP_000619389.1.22359 WP_000619389.1.22363 WP_000619389.1.22381 WP_000619389.1.22409 WP_000619389.1.2242 WP_000619389.1.22431 WP_000619389.1.2245 WP_000619389.1.22450 WP_000619389.1.22464 WP_000619389.1.22470 WP_000619389.1.22494 WP_000619389.1.22501 WP_000619389.1.22508 WP_000619389.1.22522 WP_000619389.1.22543 WP_000619389.1.22544 WP_000619389.1.22549 WP_000619389.1.22571 WP_000619389.1.22572 WP_000619389.1.22574 WP_000619389.1.22576 WP_000619389.1.22579 WP_000619389.1.22594 WP_000619389.1.22599 WP_000619389.1.22602 WP_000619389.1.22631 WP_000619389.1.22632 WP_000619389.1.22641 WP_000619389.1.22649 WP_000619389.1.22662 WP_000619389.1.22667 WP_000619389.1.22669 WP_000619389.1.22685 WP_000619389.1.22690 WP_000619389.1.22691 WP_000619389.1.22743 WP_000619389.1.22756 WP_000619389.1.22757 WP_000619389.1.22759 WP_000619389.1.22765 WP_000619389.1.22771 WP_000619389.1.22777 WP_000619389.1.22783 WP_000619389.1.22809 WP_000619389.1.22814 WP_000619389.1.22824 WP_000619389.1.22827 WP_000619389.1.22830 WP_000619389.1.22846 WP_000619389.1.22868 WP_000619389.1.22875 WP_000619389.1.22878 WP_000619389.1.22885 WP_000619389.1.22896 WP_000619389.1.22908 WP_000619389.1.22917 WP_000619389.1.22925 WP_000619389.1.22939 WP_000619389.1.22961 WP_000619389.1.22988 WP_000619389.1.22990 WP_000619389.1.22993 WP_000619389.1.2300 WP_000619389.1.23005 WP_000619389.1.23021 WP_000619389.1.23026 WP_000619389.1.23035 WP_000619389.1.23042 WP_000619389.1.23044 WP_000619389.1.23045 WP_000619389.1.23057 WP_000619389.1.23062 WP_000619389.1.23073 WP_000619389.1.23078 WP_000619389.1.23081 WP_000619389.1.23090 WP_000619389.1.23092 WP_000619389.1.23105 WP_000619389.1.23109 WP_000619389.1.23115 WP_000619389.1.23120 WP_000619389.1.23135 WP_000619389.1.2322 WP_000619389.1.23230 WP_000619389.1.23241 WP_000619389.1.2325 WP_000619389.1.23257 WP_000619389.1.23270 WP_000619389.1.23282 WP_000619389.1.23285 WP_000619389.1.23290 WP_000619389.1.23293 WP_000619389.1.23299 WP_000619389.1.23323 WP_000619389.1.23330 WP_000619389.1.23351 WP_000619389.1.23352 WP_000619389.1.23355 WP_000619389.1.23376 WP_000619389.1.23378 WP_000619389.1.23383 WP_000619389.1.23386 WP_000619389.1.23388 WP_000619389.1.23393 WP_000619389.1.23435 WP_000619389.1.23443 WP_000619389.1.23456 WP_000619389.1.23463 WP_000619389.1.23467 WP_000619389.1.23486 WP_000619389.1.23487 WP_000619389.1.23511 WP_000619389.1.23520 WP_000619389.1.23522 WP_000619389.1.23527 WP_000619389.1.2353 WP_000619389.1.23549 WP_000619389.1.23554 WP_000619389.1.23561 WP_000619389.1.23563 WP_000619389.1.23575 WP_000619389.1.23584 WP_000619389.1.23593 WP_000619389.1.2362 WP_000619389.1.23622 WP_000619389.1.23625 WP_000619389.1.23640 WP_000619389.1.23660 WP_000619389.1.23676 WP_000619389.1.23686 WP_000619389.1.23693 WP_000619389.1.23700 WP_000619389.1.23711 WP_000619389.1.23724 WP_000619389.1.23729 WP_000619389.1.23741 WP_000619389.1.23752 WP_000619389.1.23754 WP_000619389.1.23765 WP_000619389.1.23790 WP_000619389.1.23795 WP_000619389.1.23804 WP_000619389.1.23806 WP_000619389.1.23812 WP_000619389.1.23838 WP_000619389.1.23840 WP_000619389.1.23855 WP_000619389.1.23869 WP_000619389.1.2388 WP_000619389.1.23881 WP_000619389.1.23886 WP_000619389.1.23890 WP_000619389.1.23895 WP_000619389.1.23898 WP_000619389.1.23899 WP_000619389.1.23914 WP_000619389.1.23915 WP_000619389.1.23931 WP_000619389.1.23945 WP_000619389.1.2395 WP_000619389.1.23950 WP_000619389.1.23953 WP_000619389.1.23960 WP_000619389.1.23962 WP_000619389.1.23970 WP_000619389.1.23971 WP_000619389.1.23973 WP_000619389.1.23984 WP_000619389.1.23985 WP_000619389.1.24 WP_000619389.1.24004 WP_000619389.1.24024 WP_000619389.1.24038 WP_000619389.1.24045 WP_000619389.1.24051 WP_000619389.1.24058 WP_000619389.1.24068 WP_000619389.1.24070 WP_000619389.1.24088 WP_000619389.1.24089 WP_000619389.1.24120 WP_000619389.1.24122 WP_000619389.1.24124 WP_000619389.1.24127 WP_000619389.1.2413 WP_000619389.1.24136 WP_000619389.1.24169 WP_000619389.1.24170 WP_000619389.1.24177 WP_000619389.1.2418 WP_000619389.1.24194 WP_000619389.1.24233 WP_000619389.1.24278 WP_000619389.1.2428 WP_000619389.1.24283 WP_000619389.1.24290 WP_000619389.1.2430 WP_000619389.1.24304 WP_000619389.1.24316 WP_000619389.1.2433 WP_000619389.1.24341 WP_000619389.1.24362 WP_000619389.1.2437 WP_000619389.1.24374 WP_000619389.1.24381 WP_000619389.1.24383 WP_000619389.1.24458 WP_000619389.1.24460 WP_000619389.1.24473 WP_000619389.1.24483 WP_000619389.1.24485 WP_000619389.1.2449 WP_000619389.1.24499 WP_000619389.1.24523 WP_000619389.1.24524 WP_000619389.1.24533 WP_000619389.1.24536 WP_000619389.1.24547 WP_000619389.1.2456 WP_000619389.1.24560 WP_000619389.1.24570 WP_000619389.1.24575 WP_000619389.1.24577 WP_000619389.1.24583 WP_000619389.1.24592 WP_000619389.1.24616 WP_000619389.1.24634 WP_000619389.1.24641 WP_000619389.1.24642 WP_000619389.1.24646 WP_000619389.1.24650 WP_000619389.1.2469 WP_000619389.1.24693 WP_000619389.1.24695 WP_000619389.1.24703 WP_000619389.1.24752 WP_000619389.1.24753 WP_000619389.1.24758 WP_000619389.1.24763 WP_000619389.1.24783 WP_000619389.1.2479 WP_000619389.1.24791 WP_000619389.1.24797 WP_000619389.1.24799 WP_000619389.1.24808 WP_000619389.1.24849 WP_000619389.1.24854 WP_000619389.1.24870 WP_000619389.1.24876 WP_000619389.1.24899 WP_000619389.1.24902 WP_000619389.1.24906 WP_000619389.1.24909 WP_000619389.1.24926 WP_000619389.1.24929 WP_000619389.1.24939 WP_000619389.1.24946 WP_000619389.1.24960 WP_000619389.1.24968 WP_000619389.1.24979 WP_000619389.1.24981 WP_000619389.1.24982 WP_000619389.1.24984 WP_000619389.1.2502 WP_000619389.1.25021 WP_000619389.1.25038 WP_000619389.1.25039 WP_000619389.1.2504 WP_000619389.1.25050 WP_000619389.1.25060 WP_000619389.1.25076 WP_000619389.1.25079 WP_000619389.1.25082 WP_000619389.1.25085 WP_000619389.1.25086 WP_000619389.1.25087 WP_000619389.1.25088 WP_000619389.1.2512 WP_000619389.1.25126 WP_000619389.1.25141 WP_000619389.1.25174 WP_000619389.1.25183 WP_000619389.1.25193 WP_000619389.1.25201 WP_000619389.1.25203 WP_000619389.1.25204 WP_000619389.1.25248 WP_000619389.1.25270 WP_000619389.1.25289 WP_000619389.1.25305 WP_000619389.1.2531 WP_000619389.1.25312 WP_000619389.1.25324 WP_000619389.1.25346 WP_000619389.1.2537 WP_000619389.1.25372 WP_000619389.1.25378 WP_000619389.1.25380 WP_000619389.1.254 WP_000619389.1.2540 WP_000619389.1.25403 WP_000619389.1.25414 WP_000619389.1.25420 WP_000619389.1.2543 WP_000619389.1.25446 WP_000619389.1.25480 WP_000619389.1.255 WP_000619389.1.25517 WP_000619389.1.25525 WP_000619389.1.25526 WP_000619389.1.25548 WP_000619389.1.25577 WP_000619389.1.2558 WP_000619389.1.25592 WP_000619389.1.25598 WP_000619389.1.25602 WP_000619389.1.25612 WP_000619389.1.25613 WP_000619389.1.25631 WP_000619389.1.25643 WP_000619389.1.25652 WP_000619389.1.2567 WP_000619389.1.25680 WP_000619389.1.25681 WP_000619389.1.25701 WP_000619389.1.25712 WP_000619389.1.25713 WP_000619389.1.25717 WP_000619389.1.25718 WP_000619389.1.25724 WP_000619389.1.25726 WP_000619389.1.25750 WP_000619389.1.25753 WP_000619389.1.25755 WP_000619389.1.25794 WP_000619389.1.25799 WP_000619389.1.25819 WP_000619389.1.25831 WP_000619389.1.25832 WP_000619389.1.25855 WP_000619389.1.25869 WP_000619389.1.25873 WP_000619389.1.2588 WP_000619389.1.25886 WP_000619389.1.2589 WP_000619389.1.25890 WP_000619389.1.25895 WP_000619389.1.25915 WP_000619389.1.25945 WP_000619389.1.2597 WP_000619389.1.25996 WP_000619389.1.26005 WP_000619389.1.26040 WP_000619389.1.26048 WP_000619389.1.26055 WP_000619389.1.2606 WP_000619389.1.26061 WP_000619389.1.26066 WP_000619389.1.26076 WP_000619389.1.26092 WP_000619389.1.26100 WP_000619389.1.26105 WP_000619389.1.2612 WP_000619389.1.26121 WP_000619389.1.26125 WP_000619389.1.26130 WP_000619389.1.26131 WP_000619389.1.26134 WP_000619389.1.26135 WP_000619389.1.26150 WP_000619389.1.26161 WP_000619389.1.26175 WP_000619389.1.26186 WP_000619389.1.26189 WP_000619389.1.26191 WP_000619389.1.26196 WP_000619389.1.26259 WP_000619389.1.26262 WP_000619389.1.26264 WP_000619389.1.26270 WP_000619389.1.26284 WP_000619389.1.26304 WP_000619389.1.26325 WP_000619389.1.26331 WP_000619389.1.2637 WP_000619389.1.26379 WP_000619389.1.26391 WP_000619389.1.26398 WP_000619389.1.26401 WP_000619389.1.26403 WP_000619389.1.26419 WP_000619389.1.2642 WP_000619389.1.26438 WP_000619389.1.26467 WP_000619389.1.26474 WP_000619389.1.26479 WP_000619389.1.26480 WP_000619389.1.26517 WP_000619389.1.26525 WP_000619389.1.26569 WP_000619389.1.26570 WP_000619389.1.26574 WP_000619389.1.26575 WP_000619389.1.26579 WP_000619389.1.26588 WP_000619389.1.26590 WP_000619389.1.26598 WP_000619389.1.26609 WP_000619389.1.26613 WP_000619389.1.26627 WP_000619389.1.26644 WP_000619389.1.2665 WP_000619389.1.26658 WP_000619389.1.26659 WP_000619389.1.26660 WP_000619389.1.26683 WP_000619389.1.26688 WP_000619389.1.26716 WP_000619389.1.26720 WP_000619389.1.26736 WP_000619389.1.26761 WP_000619389.1.26766 WP_000619389.1.26782 WP_000619389.1.26837 WP_000619389.1.26839 WP_000619389.1.26861 WP_000619389.1.26878 WP_000619389.1.2688 WP_000619389.1.26912 WP_000619389.1.26932 WP_000619389.1.26941 WP_000619389.1.26943 WP_000619389.1.2695 WP_000619389.1.26950 WP_000619389.1.26975 WP_000619389.1.26987 WP_000619389.1.26995 WP_000619389.1.26998 WP_000619389.1.2700 WP_000619389.1.27019 WP_000619389.1.27043 WP_000619389.1.27057 WP_000619389.1.27060 WP_000619389.1.27091 WP_000619389.1.27098 WP_000619389.1.27101 WP_000619389.1.27105 WP_000619389.1.2712 WP_000619389.1.27134 WP_000619389.1.27141 WP_000619389.1.27148 WP_000619389.1.27175 WP_000619389.1.27188 WP_000619389.1.27214 WP_000619389.1.27234 WP_000619389.1.27260 WP_000619389.1.27280 WP_000619389.1.27283 WP_000619389.1.27287 WP_000619389.1.27292 WP_000619389.1.2731 WP_000619389.1.27310 WP_000619389.1.27313 WP_000619389.1.27330 WP_000619389.1.27338 WP_000619389.1.27367 WP_000619389.1.27373 WP_000619389.1.27396 WP_000619389.1.27401 WP_000619389.1.27424 WP_000619389.1.27426 WP_000619389.1.27445 WP_000619389.1.2745 WP_000619389.1.27451 WP_000619389.1.27472 WP_000619389.1.27504 WP_000619389.1.27518 WP_000619389.1.27520 WP_000619389.1.27524 WP_000619389.1.2755 WP_000619389.1.27560 WP_000619389.1.27580 WP_000619389.1.27585 WP_000619389.1.27611 WP_000619389.1.27618 WP_000619389.1.27683 WP_000619389.1.27691 WP_000619389.1.27693 WP_000619389.1.27698 WP_000619389.1.27723 WP_000619389.1.27734 WP_000619389.1.27741 WP_000619389.1.27742 WP_000619389.1.27749 WP_000619389.1.27758 WP_000619389.1.27774 WP_000619389.1.27786 WP_000619389.1.2779 WP_000619389.1.27797 WP_000619389.1.2782 WP_000619389.1.27846 WP_000619389.1.27856 WP_000619389.1.27861 WP_000619389.1.27871 WP_000619389.1.27876 WP_000619389.1.27879 WP_000619389.1.27897 WP_000619389.1.27911 WP_000619389.1.27913 WP_000619389.1.27923 WP_000619389.1.27932 WP_000619389.1.2794 WP_000619389.1.27957 WP_000619389.1.27971 WP_000619389.1.27998 WP_000619389.1.28008 WP_000619389.1.28026 WP_000619389.1.28027 WP_000619389.1.28046 WP_000619389.1.28051 WP_000619389.1.28102 WP_000619389.1.28109 WP_000619389.1.2811 WP_000619389.1.28110 WP_000619389.1.28143 WP_000619389.1.28145 WP_000619389.1.28156 WP_000619389.1.28168 WP_000619389.1.28184 WP_000619389.1.28199 WP_000619389.1.2823 WP_000619389.1.28250 WP_000619389.1.2826 WP_000619389.1.28268 WP_000619389.1.28271 WP_000619389.1.28305 WP_000619389.1.28314 WP_000619389.1.28318 WP_000619389.1.28322 WP_000619389.1.28345 WP_000619389.1.28349 WP_000619389.1.28371 WP_000619389.1.2838 WP_000619389.1.28401 WP_000619389.1.28414 WP_000619389.1.28433 WP_000619389.1.28440 WP_000619389.1.28461 WP_000619389.1.28476 WP_000619389.1.28480 WP_000619389.1.28491 WP_000619389.1.28496 WP_000619389.1.285 WP_000619389.1.28500 WP_000619389.1.28509 WP_000619389.1.28523 WP_000619389.1.28536 WP_000619389.1.28540 WP_000619389.1.28544 WP_000619389.1.28551 WP_000619389.1.28554 WP_000619389.1.28568 WP_000619389.1.28639 WP_000619389.1.2866 WP_000619389.1.28662 WP_000619389.1.28683 WP_000619389.1.28697 WP_000619389.1.28711 WP_000619389.1.28723 WP_000619389.1.28732 WP_000619389.1.28734 WP_000619389.1.28736 WP_000619389.1.28742 WP_000619389.1.28760 WP_000619389.1.28762 WP_000619389.1.28769 WP_000619389.1.28791 WP_000619389.1.28809 WP_000619389.1.2881 WP_000619389.1.28829 WP_000619389.1.28835 WP_000619389.1.28842 WP_000619389.1.28863 WP_000619389.1.28879 WP_000619389.1.28919 WP_000619389.1.28924 WP_000619389.1.28950 WP_000619389.1.28953 WP_000619389.1.28982 WP_000619389.1.28994 WP_000619389.1.290 WP_000619389.1.29001 WP_000619389.1.29013 WP_000619389.1.29016 WP_000619389.1.29026 WP_000619389.1.29049 WP_000619389.1.29055 WP_000619389.1.29061 WP_000619389.1.29079 WP_000619389.1.29082 WP_000619389.1.291 WP_000619389.1.29100 WP_000619389.1.29118 WP_000619389.1.29125 WP_000619389.1.29126 WP_000619389.1.29128 WP_000619389.1.29146 WP_000619389.1.29150 WP_000619389.1.29164 WP_000619389.1.29176 WP_000619389.1.29194 WP_000619389.1.29197 WP_000619389.1.29202 WP_000619389.1.29206 WP_000619389.1.29221 WP_000619389.1.29230 WP_000619389.1.29239 WP_000619389.1.29252 WP_000619389.1.29258 WP_000619389.1.2926 WP_000619389.1.2931 WP_000619389.1.29341 WP_000619389.1.29377 WP_000619389.1.29394 WP_000619389.1.29404 WP_000619389.1.2942 WP_000619389.1.29429 WP_000619389.1.29443 WP_000619389.1.2945 WP_000619389.1.29486 WP_000619389.1.29495 WP_000619389.1.29497 WP_000619389.1.29503 WP_000619389.1.29504 WP_000619389.1.29513 WP_000619389.1.2952 WP_000619389.1.29523 WP_000619389.1.2954 WP_000619389.1.29556 WP_000619389.1.29564 WP_000619389.1.29590 WP_000619389.1.29597 WP_000619389.1.29603 WP_000619389.1.29618 WP_000619389.1.2963 WP_000619389.1.29643 WP_000619389.1.29647 WP_000619389.1.29662 WP_000619389.1.29669 WP_000619389.1.29683 WP_000619389.1.29689 WP_000619389.1.29699 WP_000619389.1.29715 WP_000619389.1.29724 WP_000619389.1.29740 WP_000619389.1.29746 WP_000619389.1.29752 WP_000619389.1.2978 WP_000619389.1.29798 WP_000619389.1.29812 WP_000619389.1.29815 WP_000619389.1.29818 WP_000619389.1.29819 WP_000619389.1.29820 WP_000619389.1.29821 WP_000619389.1.29840 WP_000619389.1.29855 WP_000619389.1.2986 WP_000619389.1.29874 WP_000619389.1.29876 WP_000619389.1.29884 WP_000619389.1.29893 WP_000619389.1.29933 WP_000619389.1.2995 WP_000619389.1.29967 WP_000619389.1.29976 WP_000619389.1.29979 WP_000619389.1.29988 WP_000619389.1.29992 WP_000619389.1.30 WP_000619389.1.30004 WP_000619389.1.30016 WP_000619389.1.30019 WP_000619389.1.30035 WP_000619389.1.30052 WP_000619389.1.30063 WP_000619389.1.30064 WP_000619389.1.30098 WP_000619389.1.30105 WP_000619389.1.30123 WP_000619389.1.30141 WP_000619389.1.30164 WP_000619389.1.30178 WP_000619389.1.3018 WP_000619389.1.30221 WP_000619389.1.30222 WP_000619389.1.30231 WP_000619389.1.30232 WP_000619389.1.30239 WP_000619389.1.30247 WP_000619389.1.30253 WP_000619389.1.30269 WP_000619389.1.30298 WP_000619389.1.30347 WP_000619389.1.30391 WP_000619389.1.30397 WP_000619389.1.30399 WP_000619389.1.30400 WP_000619389.1.30401 WP_000619389.1.30428 WP_000619389.1.30447 WP_000619389.1.3045 WP_000619389.1.30452 WP_000619389.1.30472 WP_000619389.1.30476 WP_000619389.1.30479 WP_000619389.1.30497 WP_000619389.1.30524 WP_000619389.1.30536 WP_000619389.1.30546 WP_000619389.1.3055 WP_000619389.1.30550 WP_000619389.1.30554 WP_000619389.1.30570 WP_000619389.1.30580 WP_000619389.1.306 WP_000619389.1.3063 WP_000619389.1.30630 WP_000619389.1.30637 WP_000619389.1.30639 WP_000619389.1.30640 WP_000619389.1.30658 WP_000619389.1.30665 WP_000619389.1.30691 WP_000619389.1.30700 WP_000619389.1.30733 WP_000619389.1.30742 WP_000619389.1.30749 WP_000619389.1.30762 WP_000619389.1.30783 WP_000619389.1.30808 WP_000619389.1.3083 WP_000619389.1.30843 WP_000619389.1.30853 WP_000619389.1.30866 WP_000619389.1.30867 WP_000619389.1.30879 WP_000619389.1.30887 WP_000619389.1.30896 WP_000619389.1.309 WP_000619389.1.30905 WP_000619389.1.30906 WP_000619389.1.30918 WP_000619389.1.30960 WP_000619389.1.30987 WP_000619389.1.30993 WP_000619389.1.30999 WP_000619389.1.31000 WP_000619389.1.31009 WP_000619389.1.31017 WP_000619389.1.31026 WP_000619389.1.31029 WP_000619389.1.31055 WP_000619389.1.31083 WP_000619389.1.31089 WP_000619389.1.31119 WP_000619389.1.31129 WP_000619389.1.31142 WP_000619389.1.31149 WP_000619389.1.31154 WP_000619389.1.31188 WP_000619389.1.312 WP_000619389.1.31211 WP_000619389.1.31252 WP_000619389.1.31295 WP_000619389.1.31319 WP_000619389.1.31340 WP_000619389.1.31347 WP_000619389.1.31353 WP_000619389.1.31357 WP_000619389.1.31372 WP_000619389.1.31379 WP_000619389.1.3140 WP_000619389.1.31401 WP_000619389.1.31407 WP_000619389.1.31421 WP_000619389.1.31422 WP_000619389.1.31429 WP_000619389.1.31431 WP_000619389.1.31433 WP_000619389.1.31434 WP_000619389.1.3147 WP_000619389.1.31482 WP_000619389.1.31506 WP_000619389.1.31509 WP_000619389.1.31511 WP_000619389.1.31518 WP_000619389.1.31521 WP_000619389.1.31527 WP_000619389.1.31542 WP_000619389.1.31557 WP_000619389.1.31559 WP_000619389.1.31575 WP_000619389.1.31596 WP_000619389.1.31614 WP_000619389.1.31618 WP_000619389.1.31625 WP_000619389.1.31639 WP_000619389.1.31657 WP_000619389.1.31675 WP_000619389.1.31679 WP_000619389.1.31681 WP_000619389.1.3169 WP_000619389.1.31696 WP_000619389.1.31709 WP_000619389.1.31715 WP_000619389.1.31736 WP_000619389.1.31740 WP_000619389.1.3176 WP_000619389.1.31801 WP_000619389.1.31803 WP_000619389.1.31809 WP_000619389.1.3181 WP_000619389.1.31823 WP_000619389.1.31825 WP_000619389.1.31833 WP_000619389.1.31835 WP_000619389.1.31839 WP_000619389.1.31860 WP_000619389.1.31863 WP_000619389.1.31866 WP_000619389.1.31878 WP_000619389.1.31898 WP_000619389.1.31899 WP_000619389.1.31903 WP_000619389.1.31924 WP_000619389.1.3193 WP_000619389.1.31937 WP_000619389.1.31956 WP_000619389.1.31978 WP_000619389.1.3201 WP_000619389.1.32020 WP_000619389.1.32021 WP_000619389.1.32024 WP_000619389.1.3203 WP_000619389.1.32030 WP_000619389.1.32037 WP_000619389.1.32049 WP_000619389.1.32063 WP_000619389.1.32078 WP_000619389.1.32089 WP_000619389.1.32091 WP_000619389.1.32093 WP_000619389.1.32094 WP_000619389.1.3212 WP_000619389.1.32121 WP_000619389.1.32127 WP_000619389.1.32138 WP_000619389.1.32142 WP_000619389.1.32143 WP_000619389.1.3215 WP_000619389.1.32173 WP_000619389.1.32184 WP_000619389.1.322 WP_000619389.1.32222 WP_000619389.1.32225 WP_000619389.1.32232 WP_000619389.1.32234 WP_000619389.1.32236 WP_000619389.1.32242 WP_000619389.1.32243 WP_000619389.1.32279 WP_000619389.1.32287 WP_000619389.1.3233 WP_000619389.1.32333 WP_000619389.1.32394 WP_000619389.1.32406 WP_000619389.1.32432 WP_000619389.1.32435 WP_000619389.1.32443 WP_000619389.1.32448 WP_000619389.1.3247 WP_000619389.1.32475 WP_000619389.1.32478 WP_000619389.1.32479 WP_000619389.1.3248 WP_000619389.1.32480 WP_000619389.1.32494 WP_000619389.1.32509 WP_000619389.1.32518 WP_000619389.1.32536 WP_000619389.1.32561 WP_000619389.1.32574 WP_000619389.1.32580 WP_000619389.1.32587 WP_000619389.1.3259 WP_000619389.1.32590 WP_000619389.1.32591 WP_000619389.1.32601 WP_000619389.1.32635 WP_000619389.1.32650 WP_000619389.1.32655 WP_000619389.1.32661 WP_000619389.1.32676 WP_000619389.1.32680 WP_000619389.1.3269 WP_000619389.1.327 WP_000619389.1.32709 WP_000619389.1.32715 WP_000619389.1.32718 WP_000619389.1.32720 WP_000619389.1.32722 WP_000619389.1.32724 WP_000619389.1.32741 WP_000619389.1.32748 WP_000619389.1.32772 WP_000619389.1.32811 WP_000619389.1.32815 WP_000619389.1.32831 WP_000619389.1.32835 WP_000619389.1.32875 WP_000619389.1.32888 WP_000619389.1.32903 WP_000619389.1.32910 WP_000619389.1.32931 WP_000619389.1.32938 WP_000619389.1.32946 WP_000619389.1.3295 WP_000619389.1.32959 WP_000619389.1.32972 WP_000619389.1.32984 WP_000619389.1.32992 WP_000619389.1.32995 WP_000619389.1.33004 WP_000619389.1.33014 WP_000619389.1.33018 WP_000619389.1.33022 WP_000619389.1.33026 WP_000619389.1.33046 WP_000619389.1.33049 WP_000619389.1.33053 WP_000619389.1.33055 WP_000619389.1.33094 WP_000619389.1.33101 WP_000619389.1.33119 WP_000619389.1.33125 WP_000619389.1.33146 WP_000619389.1.33167 WP_000619389.1.33171 WP_000619389.1.33178 WP_000619389.1.33179 WP_000619389.1.33190 WP_000619389.1.33217 WP_000619389.1.33222 WP_000619389.1.3323 WP_000619389.1.33237 WP_000619389.1.33238 WP_000619389.1.33244 WP_000619389.1.33268 WP_000619389.1.33303 WP_000619389.1.33325 WP_000619389.1.33341 WP_000619389.1.33352 WP_000619389.1.33362 WP_000619389.1.33369 WP_000619389.1.33385 WP_000619389.1.334 WP_000619389.1.33408 WP_000619389.1.33410 WP_000619389.1.33413 WP_000619389.1.33422 WP_000619389.1.33424 WP_000619389.1.33428 WP_000619389.1.3344 WP_000619389.1.33475 WP_000619389.1.33476 WP_000619389.1.33502 WP_000619389.1.33512 WP_000619389.1.33525 WP_000619389.1.33526 WP_000619389.1.3354 WP_000619389.1.33561 WP_000619389.1.33563 WP_000619389.1.33565 WP_000619389.1.33584 WP_000619389.1.33595 WP_000619389.1.33631 WP_000619389.1.33638 WP_000619389.1.33648 WP_000619389.1.33667 WP_000619389.1.33680 WP_000619389.1.33729 WP_000619389.1.33736 WP_000619389.1.33745 WP_000619389.1.33751 WP_000619389.1.33780 WP_000619389.1.33799 WP_000619389.1.33823 WP_000619389.1.33853 WP_000619389.1.33854 WP_000619389.1.33879 WP_000619389.1.33888 WP_000619389.1.33896 WP_000619389.1.33905 WP_000619389.1.33914 WP_000619389.1.33948 WP_000619389.1.33952 WP_000619389.1.33973 WP_000619389.1.33979 WP_000619389.1.3398 WP_000619389.1.33981 WP_000619389.1.34003 WP_000619389.1.3401 WP_000619389.1.34032 WP_000619389.1.34094 WP_000619389.1.3411 WP_000619389.1.34117 WP_000619389.1.34121 WP_000619389.1.34122 WP_000619389.1.34124 WP_000619389.1.34130 WP_000619389.1.34144 WP_000619389.1.3415 WP_000619389.1.342 WP_000619389.1.34204 WP_000619389.1.34206 WP_000619389.1.34208 WP_000619389.1.34224 WP_000619389.1.34269 WP_000619389.1.34270 WP_000619389.1.34273 WP_000619389.1.34277 WP_000619389.1.34303 WP_000619389.1.3432 WP_000619389.1.34332 WP_000619389.1.34341 WP_000619389.1.34348 WP_000619389.1.34362 WP_000619389.1.34363 WP_000619389.1.34380 WP_000619389.1.34383 WP_000619389.1.3439 WP_000619389.1.34397 WP_000619389.1.34400 WP_000619389.1.34422 WP_000619389.1.3444 WP_000619389.1.34440 WP_000619389.1.34441 WP_000619389.1.34444 WP_000619389.1.34456 WP_000619389.1.34464 WP_000619389.1.34470 WP_000619389.1.34500 WP_000619389.1.34528 WP_000619389.1.34532 WP_000619389.1.34538 WP_000619389.1.34541 WP_000619389.1.34557 WP_000619389.1.34558 WP_000619389.1.3460 WP_000619389.1.34605 WP_000619389.1.34617 WP_000619389.1.34655 WP_000619389.1.34668 WP_000619389.1.34675 WP_000619389.1.34680 WP_000619389.1.34682 WP_000619389.1.34683 WP_000619389.1.34686 WP_000619389.1.3469 WP_000619389.1.347 WP_000619389.1.3472 WP_000619389.1.34727 WP_000619389.1.34763 WP_000619389.1.34781 WP_000619389.1.34782 WP_000619389.1.34794 WP_000619389.1.34827 WP_000619389.1.34835 WP_000619389.1.34838 WP_000619389.1.34855 WP_000619389.1.34875 WP_000619389.1.34887 WP_000619389.1.34913 WP_000619389.1.34931 WP_000619389.1.34948 WP_000619389.1.34983 WP_000619389.1.34990 WP_000619389.1.34993 WP_000619389.1.35003 WP_000619389.1.35006 WP_000619389.1.35007 WP_000619389.1.35012 WP_000619389.1.35039 WP_000619389.1.35107 WP_000619389.1.35114 WP_000619389.1.35132 WP_000619389.1.3515 WP_000619389.1.35168 WP_000619389.1.35180 WP_000619389.1.35186 WP_000619389.1.35195 WP_000619389.1.35198 WP_000619389.1.35202 WP_000619389.1.35204 WP_000619389.1.35208 WP_000619389.1.3521 WP_000619389.1.35211 WP_000619389.1.35220 WP_000619389.1.35253 WP_000619389.1.35258 WP_000619389.1.35316 WP_000619389.1.35328 WP_000619389.1.35349 WP_000619389.1.35360 WP_000619389.1.35365 WP_000619389.1.35368 WP_000619389.1.35376 WP_000619389.1.3539 WP_000619389.1.35393 WP_000619389.1.35394 WP_000619389.1.35398 WP_000619389.1.35448 WP_000619389.1.35464 WP_000619389.1.35465 WP_000619389.1.35466 WP_000619389.1.35468 WP_000619389.1.35483 WP_000619389.1.3550 WP_000619389.1.35552 WP_000619389.1.35578 WP_000619389.1.3560 WP_000619389.1.35604 WP_000619389.1.35627 WP_000619389.1.35632 WP_000619389.1.35649 WP_000619389.1.35651 WP_000619389.1.35653 WP_000619389.1.35654 WP_000619389.1.35698 WP_000619389.1.35704 WP_000619389.1.35724 WP_000619389.1.35740 WP_000619389.1.35741 WP_000619389.1.35744 WP_000619389.1.35789 WP_000619389.1.35889 WP_000619389.1.35904 WP_000619389.1.35922 WP_000619389.1.35927 WP_000619389.1.35934 WP_000619389.1.35942 WP_000619389.1.35959 WP_000619389.1.35963 WP_000619389.1.3598 WP_000619389.1.35983 WP_000619389.1.35985 WP_000619389.1.35987 WP_000619389.1.35990 WP_000619389.1.3600 WP_000619389.1.36010 WP_000619389.1.36040 WP_000619389.1.36042 WP_000619389.1.36070 WP_000619389.1.36071 WP_000619389.1.36085 WP_000619389.1.36094 WP_000619389.1.36105 WP_000619389.1.36129 WP_000619389.1.36132 WP_000619389.1.36158 WP_000619389.1.36159 WP_000619389.1.36164 WP_000619389.1.36166 WP_000619389.1.36177 WP_000619389.1.36182 WP_000619389.1.3620 WP_000619389.1.36207 WP_000619389.1.36212 WP_000619389.1.3624 WP_000619389.1.36281 WP_000619389.1.36299 WP_000619389.1.36332 WP_000619389.1.36334 WP_000619389.1.36352 WP_000619389.1.36386 WP_000619389.1.36393 WP_000619389.1.36405 WP_000619389.1.36412 WP_000619389.1.36414 WP_000619389.1.36426 WP_000619389.1.3643 WP_000619389.1.36453 WP_000619389.1.36459 WP_000619389.1.36496 WP_000619389.1.365 WP_000619389.1.36500 WP_000619389.1.36507 WP_000619389.1.36523 WP_000619389.1.36531 WP_000619389.1.36537 WP_000619389.1.36545 WP_000619389.1.36610 WP_000619389.1.36626 WP_000619389.1.36627 WP_000619389.1.36628 WP_000619389.1.36667 WP_000619389.1.3668 WP_000619389.1.36699 WP_000619389.1.36707 WP_000619389.1.3671 WP_000619389.1.36724 WP_000619389.1.36739 WP_000619389.1.36746 WP_000619389.1.36747 WP_000619389.1.36761 WP_000619389.1.36767 WP_000619389.1.36786 WP_000619389.1.36799 WP_000619389.1.36806 WP_000619389.1.36812 WP_000619389.1.36817 WP_000619389.1.36826 WP_000619389.1.36833 WP_000619389.1.36856 WP_000619389.1.36886 WP_000619389.1.36894 WP_000619389.1.36904 WP_000619389.1.36925 WP_000619389.1.3697 WP_000619389.1.36971 WP_000619389.1.36975 WP_000619389.1.37006 WP_000619389.1.37020 WP_000619389.1.37032 WP_000619389.1.37046 WP_000619389.1.37049 WP_000619389.1.37057 WP_000619389.1.37076 WP_000619389.1.37099 WP_000619389.1.37101 WP_000619389.1.37102 WP_000619389.1.37103 WP_000619389.1.37122 WP_000619389.1.37146 WP_000619389.1.37153 WP_000619389.1.37155 WP_000619389.1.37206 WP_000619389.1.37226 WP_000619389.1.3723 WP_000619389.1.37233 WP_000619389.1.37252 WP_000619389.1.37261 WP_000619389.1.37266 WP_000619389.1.37290 WP_000619389.1.3730 WP_000619389.1.37306 WP_000619389.1.37312 WP_000619389.1.37313 WP_000619389.1.37329 WP_000619389.1.37334 WP_000619389.1.37337 WP_000619389.1.37342 WP_000619389.1.37352 WP_000619389.1.37360 WP_000619389.1.37371 WP_000619389.1.37372 WP_000619389.1.37388 WP_000619389.1.37419 WP_000619389.1.37423 WP_000619389.1.37433 WP_000619389.1.37445 WP_000619389.1.37472 WP_000619389.1.37476 WP_000619389.1.37477 WP_000619389.1.37485 WP_000619389.1.3749 WP_000619389.1.37510 WP_000619389.1.37516 WP_000619389.1.37538 WP_000619389.1.37543 WP_000619389.1.37544 WP_000619389.1.37548 WP_000619389.1.37549 WP_000619389.1.37550 WP_000619389.1.37554 WP_000619389.1.37576 WP_000619389.1.37588 WP_000619389.1.37592 WP_000619389.1.37608 WP_000619389.1.3762 WP_000619389.1.37634 WP_000619389.1.37637 WP_000619389.1.37664 WP_000619389.1.377 WP_000619389.1.3772 WP_000619389.1.37730 WP_000619389.1.37731 WP_000619389.1.37736 WP_000619389.1.37745 WP_000619389.1.37750 WP_000619389.1.37758 WP_000619389.1.37762 WP_000619389.1.37766 WP_000619389.1.37769 WP_000619389.1.37773 WP_000619389.1.37817 WP_000619389.1.37830 WP_000619389.1.37847 WP_000619389.1.37852 WP_000619389.1.37853 WP_000619389.1.3788 WP_000619389.1.37880 WP_000619389.1.37887 WP_000619389.1.37897 WP_000619389.1.37917 WP_000619389.1.37923 WP_000619389.1.37926 WP_000619389.1.37940 WP_000619389.1.3795 WP_000619389.1.3796 WP_000619389.1.37962 WP_000619389.1.37964 WP_000619389.1.37967 WP_000619389.1.37984 WP_000619389.1.37995 WP_000619389.1.37998 WP_000619389.1.38000 WP_000619389.1.38033 WP_000619389.1.38043 WP_000619389.1.38050 WP_000619389.1.38063 WP_000619389.1.38080 WP_000619389.1.38081 WP_000619389.1.38085 WP_000619389.1.38103 WP_000619389.1.38105 WP_000619389.1.38107 WP_000619389.1.3811 WP_000619389.1.38119 WP_000619389.1.38120 WP_000619389.1.3815 WP_000619389.1.38155 WP_000619389.1.38162 WP_000619389.1.38182 WP_000619389.1.38185 WP_000619389.1.38194 WP_000619389.1.38202 WP_000619389.1.38211 WP_000619389.1.3822 WP_000619389.1.38234 WP_000619389.1.38257 WP_000619389.1.38264 WP_000619389.1.38293 WP_000619389.1.38300 WP_000619389.1.38306 WP_000619389.1.38314 WP_000619389.1.38323 WP_000619389.1.38357 WP_000619389.1.38363 WP_000619389.1.38369 WP_000619389.1.38371 WP_000619389.1.38392 WP_000619389.1.38412 WP_000619389.1.38419 WP_000619389.1.38485 WP_000619389.1.38544 WP_000619389.1.38561 WP_000619389.1.38584 WP_000619389.1.38610 WP_000619389.1.38626 WP_000619389.1.38629 WP_000619389.1.38636 WP_000619389.1.38694 WP_000619389.1.38722 WP_000619389.1.3873 WP_000619389.1.38751 WP_000619389.1.38777 WP_000619389.1.38782 WP_000619389.1.38811 WP_000619389.1.38827 WP_000619389.1.38835 WP_000619389.1.38843 WP_000619389.1.38896 WP_000619389.1.389 WP_000619389.1.38911 WP_000619389.1.38920 WP_000619389.1.38935 WP_000619389.1.38937 WP_000619389.1.38950 WP_000619389.1.38956 WP_000619389.1.38958 WP_000619389.1.39005 WP_000619389.1.39015 WP_000619389.1.3903 WP_000619389.1.39037 WP_000619389.1.3904 WP_000619389.1.39042 WP_000619389.1.39063 WP_000619389.1.39103 WP_000619389.1.39111 WP_000619389.1.3912 WP_000619389.1.39123 WP_000619389.1.39148 WP_000619389.1.39150 WP_000619389.1.39155 WP_000619389.1.39157 WP_000619389.1.39164 WP_000619389.1.39167 WP_000619389.1.39171 WP_000619389.1.39180 WP_000619389.1.39184 WP_000619389.1.39196 WP_000619389.1.39209 WP_000619389.1.3921 WP_000619389.1.3922 WP_000619389.1.39232 WP_000619389.1.39249 WP_000619389.1.39254 WP_000619389.1.39268 WP_000619389.1.39286 WP_000619389.1.39289 WP_000619389.1.39302 WP_000619389.1.39305 WP_000619389.1.39310 WP_000619389.1.39313 WP_000619389.1.39325 WP_000619389.1.39327 WP_000619389.1.39335 WP_000619389.1.39342 WP_000619389.1.39356 WP_000619389.1.39358 WP_000619389.1.39365 WP_000619389.1.39367 WP_000619389.1.39373 WP_000619389.1.39377 WP_000619389.1.39401 WP_000619389.1.39402 WP_000619389.1.39415 WP_000619389.1.39423 WP_000619389.1.39430 WP_000619389.1.39468 WP_000619389.1.39481 WP_000619389.1.39492 WP_000619389.1.39509 WP_000619389.1.39531 WP_000619389.1.3954 WP_000619389.1.39564 WP_000619389.1.39575 WP_000619389.1.39580 WP_000619389.1.39594 WP_000619389.1.39601 WP_000619389.1.39606 WP_000619389.1.39607 WP_000619389.1.39610 WP_000619389.1.39626 WP_000619389.1.39636 WP_000619389.1.39646 WP_000619389.1.39651 WP_000619389.1.39690 WP_000619389.1.3970 WP_000619389.1.39708 WP_000619389.1.39709 WP_000619389.1.39713 WP_000619389.1.39715 WP_000619389.1.39717 WP_000619389.1.39726 WP_000619389.1.39730 WP_000619389.1.39733 WP_000619389.1.39734 WP_000619389.1.39758 WP_000619389.1.39780 WP_000619389.1.39796 WP_000619389.1.3980 WP_000619389.1.39809 WP_000619389.1.39818 WP_000619389.1.39820 WP_000619389.1.39822 WP_000619389.1.39829 WP_000619389.1.39867 WP_000619389.1.39870 WP_000619389.1.39892 WP_000619389.1.39938 WP_000619389.1.39961 WP_000619389.1.39966 WP_000619389.1.39970 WP_000619389.1.39973 WP_000619389.1.39992 WP_000619389.1.39998 WP_000619389.1.40 WP_000619389.1.40013 WP_000619389.1.40016 WP_000619389.1.40019 WP_000619389.1.4005 WP_000619389.1.40083 WP_000619389.1.40088 WP_000619389.1.40107 WP_000619389.1.40113 WP_000619389.1.40121 WP_000619389.1.40140 WP_000619389.1.40147 WP_000619389.1.40153 WP_000619389.1.40159 WP_000619389.1.40183 WP_000619389.1.40190 WP_000619389.1.40192 WP_000619389.1.4020 WP_000619389.1.40206 WP_000619389.1.40211 WP_000619389.1.40212 WP_000619389.1.40218 WP_000619389.1.40234 WP_000619389.1.40238 WP_000619389.1.40249 WP_000619389.1.40298 WP_000619389.1.4030 WP_000619389.1.40300 WP_000619389.1.40315 WP_000619389.1.40317 WP_000619389.1.40319 WP_000619389.1.40335 WP_000619389.1.40345 WP_000619389.1.40349 WP_000619389.1.40360 WP_000619389.1.40382 WP_000619389.1.40389 WP_000619389.1.40391 WP_000619389.1.40403 WP_000619389.1.40445 WP_000619389.1.40486 WP_000619389.1.4049 WP_000619389.1.40499 WP_000619389.1.40502 WP_000619389.1.40509 WP_000619389.1.40524 WP_000619389.1.40539 WP_000619389.1.40548 WP_000619389.1.40549 WP_000619389.1.40560 WP_000619389.1.40563 WP_000619389.1.40596 WP_000619389.1.40599 WP_000619389.1.406 WP_000619389.1.40607 WP_000619389.1.40617 WP_000619389.1.40623 WP_000619389.1.40629 WP_000619389.1.40636 WP_000619389.1.40657 WP_000619389.1.40660 WP_000619389.1.40666 WP_000619389.1.40668 WP_000619389.1.40686 WP_000619389.1.40712 WP_000619389.1.40715 WP_000619389.1.40742 WP_000619389.1.40758 WP_000619389.1.40781 WP_000619389.1.40793 WP_000619389.1.4081 WP_000619389.1.40813 WP_000619389.1.40815 WP_000619389.1.4082 WP_000619389.1.40833 WP_000619389.1.40842 WP_000619389.1.40843 WP_000619389.1.40865 WP_000619389.1.40882 WP_000619389.1.40893 WP_000619389.1.40898 WP_000619389.1.40900 WP_000619389.1.40912 WP_000619389.1.40937 WP_000619389.1.40952 WP_000619389.1.40965 WP_000619389.1.4103 WP_000619389.1.41037 WP_000619389.1.41041 WP_000619389.1.41045 WP_000619389.1.41060 WP_000619389.1.41063 WP_000619389.1.41078 WP_000619389.1.41113 WP_000619389.1.41125 WP_000619389.1.41147 WP_000619389.1.41206 WP_000619389.1.4122 WP_000619389.1.41230 WP_000619389.1.41239 WP_000619389.1.41244 WP_000619389.1.41259 WP_000619389.1.4126 WP_000619389.1.41263 WP_000619389.1.41271 WP_000619389.1.41287 WP_000619389.1.41294 WP_000619389.1.41315 WP_000619389.1.41330 WP_000619389.1.41332 WP_000619389.1.41339 WP_000619389.1.41346 WP_000619389.1.41363 WP_000619389.1.41368 WP_000619389.1.41371 WP_000619389.1.41372 WP_000619389.1.41391 WP_000619389.1.41392 WP_000619389.1.41394 WP_000619389.1.41401 WP_000619389.1.41402 WP_000619389.1.41407 WP_000619389.1.41417 WP_000619389.1.4142 WP_000619389.1.41436 WP_000619389.1.41449 WP_000619389.1.41453 WP_000619389.1.41455 WP_000619389.1.41457 WP_000619389.1.41466 WP_000619389.1.41478 WP_000619389.1.41479 WP_000619389.1.41481 WP_000619389.1.41482 WP_000619389.1.41483 WP_000619389.1.41484 WP_000619389.1.41488 WP_000619389.1.41513 WP_000619389.1.41530 WP_000619389.1.41536 WP_000619389.1.41539 WP_000619389.1.41545 WP_000619389.1.41556 WP_000619389.1.41566 WP_000619389.1.4158 WP_000619389.1.41606 WP_000619389.1.41613 WP_000619389.1.41621 WP_000619389.1.41651 WP_000619389.1.41654 WP_000619389.1.41712 WP_000619389.1.41718 WP_000619389.1.4172 WP_000619389.1.41734 WP_000619389.1.41740 WP_000619389.1.41741 WP_000619389.1.41752 WP_000619389.1.41778 WP_000619389.1.41780 WP_000619389.1.41782 WP_000619389.1.41783 WP_000619389.1.41784 WP_000619389.1.41809 WP_000619389.1.41812 WP_000619389.1.41813 WP_000619389.1.41822 WP_000619389.1.41826 WP_000619389.1.41837 WP_000619389.1.41847 WP_000619389.1.41849 WP_000619389.1.41884 WP_000619389.1.41885 WP_000619389.1.4189 WP_000619389.1.41900 WP_000619389.1.41923 WP_000619389.1.4193 WP_000619389.1.41956 WP_000619389.1.41960 WP_000619389.1.41964 WP_000619389.1.41988 WP_000619389.1.41990 WP_000619389.1.41991 WP_000619389.1.42022 WP_000619389.1.42027 WP_000619389.1.42033 WP_000619389.1.42036 WP_000619389.1.42038 WP_000619389.1.42044 WP_000619389.1.42060 WP_000619389.1.42073 WP_000619389.1.42095 WP_000619389.1.42096 WP_000619389.1.42113 WP_000619389.1.4213 WP_000619389.1.42138 WP_000619389.1.4214 WP_000619389.1.42151 WP_000619389.1.42159 WP_000619389.1.42179 WP_000619389.1.42191 WP_000619389.1.42203 WP_000619389.1.42209 WP_000619389.1.42214 WP_000619389.1.42221 WP_000619389.1.42226 WP_000619389.1.42228 WP_000619389.1.42233 WP_000619389.1.4224 WP_000619389.1.42252 WP_000619389.1.42258 WP_000619389.1.42277 WP_000619389.1.42284 WP_000619389.1.42300 WP_000619389.1.42318 WP_000619389.1.42350 WP_000619389.1.42359 WP_000619389.1.42367 WP_000619389.1.42369 WP_000619389.1.42376 WP_000619389.1.42387 WP_000619389.1.42413 WP_000619389.1.42415 WP_000619389.1.4242 WP_000619389.1.42432 WP_000619389.1.42442 WP_000619389.1.42443 WP_000619389.1.42447 WP_000619389.1.42448 WP_000619389.1.42456 WP_000619389.1.42480 WP_000619389.1.4250 WP_000619389.1.42513 WP_000619389.1.42516 WP_000619389.1.42522 WP_000619389.1.42547 WP_000619389.1.42586 WP_000619389.1.42594 WP_000619389.1.42597 WP_000619389.1.42600 WP_000619389.1.42601 WP_000619389.1.4261 WP_000619389.1.42632 WP_000619389.1.42638 WP_000619389.1.42661 WP_000619389.1.42669 WP_000619389.1.42670 WP_000619389.1.42677 WP_000619389.1.42709 WP_000619389.1.42728 WP_000619389.1.42748 WP_000619389.1.42749 WP_000619389.1.42750 WP_000619389.1.42756 WP_000619389.1.42761 WP_000619389.1.42770 WP_000619389.1.42771 WP_000619389.1.42791 WP_000619389.1.42804 WP_000619389.1.42808 WP_000619389.1.42813 WP_000619389.1.4282 WP_000619389.1.42828 WP_000619389.1.42830 WP_000619389.1.42832 WP_000619389.1.42863 WP_000619389.1.42879 WP_000619389.1.42880 WP_000619389.1.42891 WP_000619389.1.4290 WP_000619389.1.42903 WP_000619389.1.42918 WP_000619389.1.42936 WP_000619389.1.42937 WP_000619389.1.42950 WP_000619389.1.42962 WP_000619389.1.42966 WP_000619389.1.42970 WP_000619389.1.42975 WP_000619389.1.42987 WP_000619389.1.42991 WP_000619389.1.43013 WP_000619389.1.43027 WP_000619389.1.43035 WP_000619389.1.4306 WP_000619389.1.43079 WP_000619389.1.43121 WP_000619389.1.43123 WP_000619389.1.4313 WP_000619389.1.43132 WP_000619389.1.43133 WP_000619389.1.43137 WP_000619389.1.43140 WP_000619389.1.43166 WP_000619389.1.43170 WP_000619389.1.43174 WP_000619389.1.43177 WP_000619389.1.43196 WP_000619389.1.43213 WP_000619389.1.43216 WP_000619389.1.43239 WP_000619389.1.43270 WP_000619389.1.43278 WP_000619389.1.43316 WP_000619389.1.43324 WP_000619389.1.4334 WP_000619389.1.43363 WP_000619389.1.43374 WP_000619389.1.43384 WP_000619389.1.43389 WP_000619389.1.4342 WP_000619389.1.43422 WP_000619389.1.43427 WP_000619389.1.4343 WP_000619389.1.43444 WP_000619389.1.43448 WP_000619389.1.43455 WP_000619389.1.43469 WP_000619389.1.43473 WP_000619389.1.43474 WP_000619389.1.43489 WP_000619389.1.43501 WP_000619389.1.43536 WP_000619389.1.4356 WP_000619389.1.43561 WP_000619389.1.43566 WP_000619389.1.43598 WP_000619389.1.436 WP_000619389.1.43604 WP_000619389.1.43642 WP_000619389.1.43720 WP_000619389.1.43733 WP_000619389.1.43738 WP_000619389.1.43750 WP_000619389.1.43754 WP_000619389.1.43769 WP_000619389.1.43798 WP_000619389.1.43803 WP_000619389.1.43804 WP_000619389.1.43816 WP_000619389.1.43837 WP_000619389.1.43858 WP_000619389.1.43868 WP_000619389.1.43898 WP_000619389.1.43911 WP_000619389.1.43918 WP_000619389.1.43925 WP_000619389.1.43939 WP_000619389.1.43942 WP_000619389.1.43953 WP_000619389.1.43966 WP_000619389.1.43989 WP_000619389.1.440 WP_000619389.1.4400 WP_000619389.1.44018 WP_000619389.1.44020 WP_000619389.1.44029 WP_000619389.1.44040 WP_000619389.1.44051 WP_000619389.1.44075 WP_000619389.1.44077 WP_000619389.1.44088 WP_000619389.1.44096 WP_000619389.1.44100 WP_000619389.1.4411 WP_000619389.1.44115 WP_000619389.1.44125 WP_000619389.1.44130 WP_000619389.1.44133 WP_000619389.1.4415 WP_000619389.1.44162 WP_000619389.1.44165 WP_000619389.1.44201 WP_000619389.1.44203 WP_000619389.1.44222 WP_000619389.1.44238 WP_000619389.1.44251 WP_000619389.1.44263 WP_000619389.1.44264 WP_000619389.1.44273 WP_000619389.1.44285 WP_000619389.1.44287 WP_000619389.1.44292 WP_000619389.1.44314 WP_000619389.1.44324 WP_000619389.1.44327 WP_000619389.1.44354 WP_000619389.1.44365 WP_000619389.1.44389 WP_000619389.1.44394 WP_000619389.1.44422 WP_000619389.1.44424 WP_000619389.1.44426 WP_000619389.1.44445 WP_000619389.1.44447 WP_000619389.1.4445 WP_000619389.1.44452 WP_000619389.1.44458 WP_000619389.1.44460 WP_000619389.1.44461 WP_000619389.1.44488 WP_000619389.1.4449 WP_000619389.1.44524 WP_000619389.1.44539 WP_000619389.1.4454 WP_000619389.1.44558 WP_000619389.1.44561 WP_000619389.1.44570 WP_000619389.1.44587 WP_000619389.1.4459 WP_000619389.1.44608 WP_000619389.1.44610 WP_000619389.1.44622 WP_000619389.1.44627 WP_000619389.1.4463 WP_000619389.1.44642 WP_000619389.1.44649 WP_000619389.1.44661 WP_000619389.1.44668 WP_000619389.1.44671 WP_000619389.1.44686 WP_000619389.1.4471 WP_000619389.1.44717 WP_000619389.1.44724 WP_000619389.1.4473 WP_000619389.1.44733 WP_000619389.1.44756 WP_000619389.1.44759 WP_000619389.1.44784 WP_000619389.1.448 WP_000619389.1.44800 WP_000619389.1.44814 WP_000619389.1.44818 WP_000619389.1.44821 WP_000619389.1.44836 WP_000619389.1.44840 WP_000619389.1.44841 WP_000619389.1.44843 WP_000619389.1.44848 WP_000619389.1.44849 WP_000619389.1.44854 WP_000619389.1.44855 WP_000619389.1.44857 WP_000619389.1.44906 WP_000619389.1.44923 WP_000619389.1.44954 WP_000619389.1.44960 WP_000619389.1.44961 WP_000619389.1.44970 WP_000619389.1.44975 WP_000619389.1.44977 WP_000619389.1.44980 WP_000619389.1.45000 WP_000619389.1.45020 WP_000619389.1.45025 WP_000619389.1.45028 WP_000619389.1.45043 WP_000619389.1.45053 WP_000619389.1.45068 WP_000619389.1.45076 WP_000619389.1.45104 WP_000619389.1.45116 WP_000619389.1.4515 WP_000619389.1.45153 WP_000619389.1.45156 WP_000619389.1.4516 WP_000619389.1.45190 WP_000619389.1.45195 WP_000619389.1.45208 WP_000619389.1.4524 WP_000619389.1.45246 WP_000619389.1.45293 WP_000619389.1.4530 WP_000619389.1.45301 WP_000619389.1.45329 WP_000619389.1.4535 WP_000619389.1.45359 WP_000619389.1.4538 WP_000619389.1.45392 WP_000619389.1.45404 WP_000619389.1.45405 WP_000619389.1.4541 WP_000619389.1.45440 WP_000619389.1.45444 WP_000619389.1.45486 WP_000619389.1.4549 WP_000619389.1.45494 WP_000619389.1.45500 WP_000619389.1.45525 WP_000619389.1.45536 WP_000619389.1.45538 WP_000619389.1.45565 WP_000619389.1.45575 WP_000619389.1.45595 WP_000619389.1.45600 WP_000619389.1.45627 WP_000619389.1.4563 WP_000619389.1.45664 WP_000619389.1.45674 WP_000619389.1.45676 WP_000619389.1.4570 WP_000619389.1.45707 WP_000619389.1.45718 WP_000619389.1.4574 WP_000619389.1.45740 WP_000619389.1.45741 WP_000619389.1.45789 WP_000619389.1.45793 WP_000619389.1.45799 WP_000619389.1.45801 WP_000619389.1.45806 WP_000619389.1.4583 WP_000619389.1.45840 WP_000619389.1.45841 WP_000619389.1.45846 WP_000619389.1.45865 WP_000619389.1.45868 WP_000619389.1.45891 WP_000619389.1.45901 WP_000619389.1.45921 WP_000619389.1.4593 WP_000619389.1.45930 WP_000619389.1.45931 WP_000619389.1.45933 WP_000619389.1.45941 WP_000619389.1.45949 WP_000619389.1.45960 WP_000619389.1.45962 WP_000619389.1.45968 WP_000619389.1.45990 WP_000619389.1.45991 WP_000619389.1.4600 WP_000619389.1.46016 WP_000619389.1.46026 WP_000619389.1.46027 WP_000619389.1.46039 WP_000619389.1.46048 WP_000619389.1.46049 WP_000619389.1.46070 WP_000619389.1.46081 WP_000619389.1.46097 WP_000619389.1.4610 WP_000619389.1.46105 WP_000619389.1.46115 WP_000619389.1.46122 WP_000619389.1.4613 WP_000619389.1.46164 WP_000619389.1.4617 WP_000619389.1.46186 WP_000619389.1.4619 WP_000619389.1.46197 WP_000619389.1.46213 WP_000619389.1.46217 WP_000619389.1.46239 WP_000619389.1.46245 WP_000619389.1.46257 WP_000619389.1.46263 WP_000619389.1.46282 WP_000619389.1.46283 WP_000619389.1.46291 WP_000619389.1.46301 WP_000619389.1.46325 WP_000619389.1.46329 WP_000619389.1.46369 WP_000619389.1.46378 WP_000619389.1.46379 WP_000619389.1.46414 WP_000619389.1.46429 WP_000619389.1.4643 WP_000619389.1.46433 WP_000619389.1.46438 WP_000619389.1.46441 WP_000619389.1.46451 WP_000619389.1.4646 WP_000619389.1.46468 WP_000619389.1.4647 WP_000619389.1.46477 WP_000619389.1.46487 WP_000619389.1.46503 WP_000619389.1.46526 WP_000619389.1.46531 WP_000619389.1.46541 WP_000619389.1.46552 WP_000619389.1.46555 WP_000619389.1.4657 WP_000619389.1.46573 WP_000619389.1.46582 WP_000619389.1.46589 WP_000619389.1.46594 WP_000619389.1.46597 WP_000619389.1.46602 WP_000619389.1.46611 WP_000619389.1.46614 WP_000619389.1.46616 WP_000619389.1.46626 WP_000619389.1.46643 WP_000619389.1.46655 WP_000619389.1.46668 WP_000619389.1.4670 WP_000619389.1.46734 WP_000619389.1.46743 WP_000619389.1.46795 WP_000619389.1.46798 WP_000619389.1.46802 WP_000619389.1.46806 WP_000619389.1.46810 WP_000619389.1.46820 WP_000619389.1.46821 WP_000619389.1.46832 WP_000619389.1.46833 WP_000619389.1.46841 WP_000619389.1.46857 WP_000619389.1.46860 WP_000619389.1.46876 WP_000619389.1.46882 WP_000619389.1.46898 WP_000619389.1.46909 WP_000619389.1.4691 WP_000619389.1.46912 WP_000619389.1.46913 WP_000619389.1.46932 WP_000619389.1.4695 WP_000619389.1.46990 WP_000619389.1.46991 WP_000619389.1.46994 WP_000619389.1.46999 WP_000619389.1.47024 WP_000619389.1.47028 WP_000619389.1.47029 WP_000619389.1.47030 WP_000619389.1.47034 WP_000619389.1.47038 WP_000619389.1.47039 WP_000619389.1.47048 WP_000619389.1.47050 WP_000619389.1.47054 WP_000619389.1.47063 WP_000619389.1.47069 WP_000619389.1.47073 WP_000619389.1.4708 WP_000619389.1.47124 WP_000619389.1.47135 WP_000619389.1.47140 WP_000619389.1.47156 WP_000619389.1.47167 WP_000619389.1.47171 WP_000619389.1.47186 WP_000619389.1.47189 WP_000619389.1.47197 WP_000619389.1.47198 WP_000619389.1.4722 WP_000619389.1.47224 WP_000619389.1.4723 WP_000619389.1.47235 WP_000619389.1.47246 WP_000619389.1.47247 WP_000619389.1.4725 WP_000619389.1.47280 WP_000619389.1.47307 WP_000619389.1.47316 WP_000619389.1.47319 WP_000619389.1.47332 WP_000619389.1.47344 WP_000619389.1.47349 WP_000619389.1.47350 WP_000619389.1.47363 WP_000619389.1.47366 WP_000619389.1.47370 WP_000619389.1.47386 WP_000619389.1.47398 WP_000619389.1.4740 WP_000619389.1.47401 WP_000619389.1.47411 WP_000619389.1.47414 WP_000619389.1.47416 WP_000619389.1.47425 WP_000619389.1.4743 WP_000619389.1.47451 WP_000619389.1.47454 WP_000619389.1.47464 WP_000619389.1.47473 WP_000619389.1.47477 WP_000619389.1.47488 WP_000619389.1.47496 WP_000619389.1.47498 WP_000619389.1.47500 WP_000619389.1.47529 WP_000619389.1.47533 WP_000619389.1.47546 WP_000619389.1.47555 WP_000619389.1.47582 WP_000619389.1.47599 WP_000619389.1.47634 WP_000619389.1.47646 WP_000619389.1.47647 WP_000619389.1.47654 WP_000619389.1.47662 WP_000619389.1.47673 WP_000619389.1.47709 WP_000619389.1.4772 WP_000619389.1.4773 WP_000619389.1.47734 WP_000619389.1.47740 WP_000619389.1.47744 WP_000619389.1.47761 WP_000619389.1.47764 WP_000619389.1.47765 WP_000619389.1.47770 WP_000619389.1.47775 WP_000619389.1.47784 WP_000619389.1.47790 WP_000619389.1.47791 WP_000619389.1.47820 WP_000619389.1.47827 WP_000619389.1.4783 WP_000619389.1.47837 WP_000619389.1.47848 WP_000619389.1.4785 WP_000619389.1.47884 WP_000619389.1.47914 WP_000619389.1.47935 WP_000619389.1.47954 WP_000619389.1.47962 WP_000619389.1.47976 WP_000619389.1.47981 WP_000619389.1.47983 WP_000619389.1.47994 WP_000619389.1.48000 WP_000619389.1.48018 WP_000619389.1.48029 WP_000619389.1.48040 WP_000619389.1.48048 WP_000619389.1.48051 WP_000619389.1.48065 WP_000619389.1.48073 WP_000619389.1.48077 WP_000619389.1.48080 WP_000619389.1.48087 WP_000619389.1.48090 WP_000619389.1.48096 WP_000619389.1.4811 WP_000619389.1.48111 WP_000619389.1.4812 WP_000619389.1.48121 WP_000619389.1.48144 WP_000619389.1.48168 WP_000619389.1.48176 WP_000619389.1.48188 WP_000619389.1.48194 WP_000619389.1.48203 WP_000619389.1.48216 WP_000619389.1.48222 WP_000619389.1.48226 WP_000619389.1.48258 WP_000619389.1.4826 WP_000619389.1.48265 WP_000619389.1.48285 WP_000619389.1.48290 WP_000619389.1.48291 WP_000619389.1.48317 WP_000619389.1.48353 WP_000619389.1.48355 WP_000619389.1.48371 WP_000619389.1.48385 WP_000619389.1.48404 WP_000619389.1.48417 WP_000619389.1.48421 WP_000619389.1.48431 WP_000619389.1.48433 WP_000619389.1.48469 WP_000619389.1.48480 WP_000619389.1.48483 WP_000619389.1.48505 WP_000619389.1.48522 WP_000619389.1.4857 WP_000619389.1.48571 WP_000619389.1.48590 WP_000619389.1.486 WP_000619389.1.48602 WP_000619389.1.48615 WP_000619389.1.48620 WP_000619389.1.48626 WP_000619389.1.48629 WP_000619389.1.48678 WP_000619389.1.48689 WP_000619389.1.48697 WP_000619389.1.4871 WP_000619389.1.48712 WP_000619389.1.4876 WP_000619389.1.48771 WP_000619389.1.48792 WP_000619389.1.48801 WP_000619389.1.48806 WP_000619389.1.48808 WP_000619389.1.48825 WP_000619389.1.48827 WP_000619389.1.48847 WP_000619389.1.48860 WP_000619389.1.48901 WP_000619389.1.48902 WP_000619389.1.48907 WP_000619389.1.48910 WP_000619389.1.4892 WP_000619389.1.48921 WP_000619389.1.48926 WP_000619389.1.48928 WP_000619389.1.48953 WP_000619389.1.48954 WP_000619389.1.48970 WP_000619389.1.48974 WP_000619389.1.49001 WP_000619389.1.49009 WP_000619389.1.49061 WP_000619389.1.49076 WP_000619389.1.49104 WP_000619389.1.49107 WP_000619389.1.49124 WP_000619389.1.49136 WP_000619389.1.49141 WP_000619389.1.49147 WP_000619389.1.49170 WP_000619389.1.49179 WP_000619389.1.49190 WP_000619389.1.49229 WP_000619389.1.49236 WP_000619389.1.49243 WP_000619389.1.49258 WP_000619389.1.49259 WP_000619389.1.49275 WP_000619389.1.4931 WP_000619389.1.49312 WP_000619389.1.49321 WP_000619389.1.49332 WP_000619389.1.49336 WP_000619389.1.49338 WP_000619389.1.49342 WP_000619389.1.49347 WP_000619389.1.49363 WP_000619389.1.49376 WP_000619389.1.49401 WP_000619389.1.49412 WP_000619389.1.49431 WP_000619389.1.49446 WP_000619389.1.49459 WP_000619389.1.49464 WP_000619389.1.49481 WP_000619389.1.49482 WP_000619389.1.49483 WP_000619389.1.4949 WP_000619389.1.49496 WP_000619389.1.49521 WP_000619389.1.49522 WP_000619389.1.49528 WP_000619389.1.4953 WP_000619389.1.49531 WP_000619389.1.49537 WP_000619389.1.49546 WP_000619389.1.49558 WP_000619389.1.49567 WP_000619389.1.49594 WP_000619389.1.49599 WP_000619389.1.49615 WP_000619389.1.49621 WP_000619389.1.49625 WP_000619389.1.49645 WP_000619389.1.49655 WP_000619389.1.49661 WP_000619389.1.49662 WP_000619389.1.49675 WP_000619389.1.49684 WP_000619389.1.497 WP_000619389.1.49712 WP_000619389.1.49722 WP_000619389.1.49733 WP_000619389.1.49740 WP_000619389.1.49747 WP_000619389.1.49768 WP_000619389.1.49771 WP_000619389.1.49774 WP_000619389.1.49777 WP_000619389.1.49783 WP_000619389.1.49788 WP_000619389.1.49794 WP_000619389.1.49820 WP_000619389.1.49823 WP_000619389.1.4985 WP_000619389.1.49856 WP_000619389.1.49861 WP_000619389.1.49879 WP_000619389.1.49883 WP_000619389.1.49884 WP_000619389.1.49900 WP_000619389.1.49902 WP_000619389.1.49941 WP_000619389.1.49950 WP_000619389.1.49954 WP_000619389.1.49972 WP_000619389.1.49987 WP_000619389.1.50006 WP_000619389.1.50008 WP_000619389.1.5003 WP_000619389.1.50036 WP_000619389.1.50056 WP_000619389.1.50058 WP_000619389.1.50078 WP_000619389.1.50098 WP_000619389.1.50110 WP_000619389.1.50113 WP_000619389.1.50136 WP_000619389.1.50146 WP_000619389.1.5017 WP_000619389.1.50179 WP_000619389.1.50182 WP_000619389.1.50187 WP_000619389.1.50191 WP_000619389.1.50196 WP_000619389.1.50207 WP_000619389.1.50228 WP_000619389.1.50230 WP_000619389.1.50258 WP_000619389.1.50262 WP_000619389.1.50269 WP_000619389.1.50270 WP_000619389.1.50273 WP_000619389.1.50278 WP_000619389.1.50304 WP_000619389.1.50329 WP_000619389.1.50345 WP_000619389.1.50353 WP_000619389.1.50358 WP_000619389.1.50361 WP_000619389.1.50366 WP_000619389.1.5037 WP_000619389.1.50380 WP_000619389.1.50381 WP_000619389.1.5040 WP_000619389.1.5041 WP_000619389.1.50412 WP_000619389.1.50418 WP_000619389.1.50427 WP_000619389.1.50446 WP_000619389.1.50452 WP_000619389.1.5046 WP_000619389.1.50539 WP_000619389.1.50548 WP_000619389.1.50549 WP_000619389.1.5056 WP_000619389.1.50564 WP_000619389.1.50579 WP_000619389.1.50585 WP_000619389.1.50586 WP_000619389.1.506 WP_000619389.1.50608 WP_000619389.1.5061 WP_000619389.1.50616 WP_000619389.1.50627 WP_000619389.1.5064 WP_000619389.1.5067 WP_000619389.1.50690 WP_000619389.1.50700 WP_000619389.1.50715 WP_000619389.1.50717 WP_000619389.1.50725 WP_000619389.1.50728 WP_000619389.1.50762 WP_000619389.1.50887 WP_000619389.1.50925 WP_000619389.1.50936 WP_000619389.1.50939 WP_000619389.1.50947 WP_000619389.1.5095 WP_000619389.1.50957 WP_000619389.1.50969 WP_000619389.1.50986 WP_000619389.1.50988 WP_000619389.1.50990 WP_000619389.1.50993 WP_000619389.1.50996 WP_000619389.1.51013 WP_000619389.1.51027 WP_000619389.1.51042 WP_000619389.1.51058 WP_000619389.1.5106 WP_000619389.1.511 WP_000619389.1.51109 WP_000619389.1.51127 WP_000619389.1.51154 WP_000619389.1.51170 WP_000619389.1.51171 WP_000619389.1.51172 WP_000619389.1.51175 WP_000619389.1.51180 WP_000619389.1.51190 WP_000619389.1.51201 WP_000619389.1.51203 WP_000619389.1.51206 WP_000619389.1.51211 WP_000619389.1.5124 WP_000619389.1.51248 WP_000619389.1.51253 WP_000619389.1.51255 WP_000619389.1.51260 WP_000619389.1.51278 WP_000619389.1.5128 WP_000619389.1.51283 WP_000619389.1.51299 WP_000619389.1.51300 WP_000619389.1.51307 WP_000619389.1.51320 WP_000619389.1.51323 WP_000619389.1.51325 WP_000619389.1.51330 WP_000619389.1.51336 WP_000619389.1.51354 WP_000619389.1.51360 WP_000619389.1.51364 WP_000619389.1.51380 WP_000619389.1.51392 WP_000619389.1.51405 WP_000619389.1.51425 WP_000619389.1.51426 WP_000619389.1.51427 WP_000619389.1.51430 WP_000619389.1.51441 WP_000619389.1.5146 WP_000619389.1.51462 WP_000619389.1.51482 WP_000619389.1.51490 WP_000619389.1.51495 WP_000619389.1.51503 WP_000619389.1.51505 WP_000619389.1.51513 WP_000619389.1.51525 WP_000619389.1.5153 WP_000619389.1.51537 WP_000619389.1.51539 WP_000619389.1.51542 WP_000619389.1.51548 WP_000619389.1.51552 WP_000619389.1.5157 WP_000619389.1.5158 WP_000619389.1.51580 WP_000619389.1.51587 WP_000619389.1.51596 WP_000619389.1.51600 WP_000619389.1.51607 WP_000619389.1.51624 WP_000619389.1.51629 WP_000619389.1.51643 WP_000619389.1.51662 WP_000619389.1.51690 WP_000619389.1.51693 WP_000619389.1.51707 WP_000619389.1.51718 WP_000619389.1.5172 WP_000619389.1.51736 WP_000619389.1.51757 WP_000619389.1.51760 WP_000619389.1.51784 WP_000619389.1.518 WP_000619389.1.51804 WP_000619389.1.51834 WP_000619389.1.51837 WP_000619389.1.51839 WP_000619389.1.51869 WP_000619389.1.51873 WP_000619389.1.51881 WP_000619389.1.51896 WP_000619389.1.51899 WP_000619389.1.51906 WP_000619389.1.51944 WP_000619389.1.51949 WP_000619389.1.51968 WP_000619389.1.51979 WP_000619389.1.51985 WP_000619389.1.51988 WP_000619389.1.5199 WP_000619389.1.51999 WP_000619389.1.52002 WP_000619389.1.52011 WP_000619389.1.52020 WP_000619389.1.52039 WP_000619389.1.52044 WP_000619389.1.52048 WP_000619389.1.52062 WP_000619389.1.52076 WP_000619389.1.52085 WP_000619389.1.52098 WP_000619389.1.52111 WP_000619389.1.52126 WP_000619389.1.52127 WP_000619389.1.52135 WP_000619389.1.52137 WP_000619389.1.5217 WP_000619389.1.52171 WP_000619389.1.52186 WP_000619389.1.52200 WP_000619389.1.52211 WP_000619389.1.52213 WP_000619389.1.52214 WP_000619389.1.52225 WP_000619389.1.52230 WP_000619389.1.52236 WP_000619389.1.52240 WP_000619389.1.52243 WP_000619389.1.52249 WP_000619389.1.52257 WP_000619389.1.52258 WP_000619389.1.5227 WP_000619389.1.52270 WP_000619389.1.52271 WP_000619389.1.52272 WP_000619389.1.52299 WP_000619389.1.52304 WP_000619389.1.52305 WP_000619389.1.52313 WP_000619389.1.52324 WP_000619389.1.52328 WP_000619389.1.52333 WP_000619389.1.52363 WP_000619389.1.52378 WP_000619389.1.5239 WP_000619389.1.52399 WP_000619389.1.52406 WP_000619389.1.52413 WP_000619389.1.52419 WP_000619389.1.52421 WP_000619389.1.52492 WP_000619389.1.52496 WP_000619389.1.52524 WP_000619389.1.52542 WP_000619389.1.52543 WP_000619389.1.52544 WP_000619389.1.52554 WP_000619389.1.52558 WP_000619389.1.52567 WP_000619389.1.52568 WP_000619389.1.52601 WP_000619389.1.52612 WP_000619389.1.52631 WP_000619389.1.5265 WP_000619389.1.52662 WP_000619389.1.52691 WP_000619389.1.52704 WP_000619389.1.52710 WP_000619389.1.5272 WP_000619389.1.52735 WP_000619389.1.52755 WP_000619389.1.52762 WP_000619389.1.52771 WP_000619389.1.52774 WP_000619389.1.52777 WP_000619389.1.52780 WP_000619389.1.52781 WP_000619389.1.52801 WP_000619389.1.52804 WP_000619389.1.52844 WP_000619389.1.52846 WP_000619389.1.5285 WP_000619389.1.52852 WP_000619389.1.52853 WP_000619389.1.52855 WP_000619389.1.52881 WP_000619389.1.52883 WP_000619389.1.52895 WP_000619389.1.52908 WP_000619389.1.5291 WP_000619389.1.52913 WP_000619389.1.52933 WP_000619389.1.52942 WP_000619389.1.52945 WP_000619389.1.52962 WP_000619389.1.52995 WP_000619389.1.52996 WP_000619389.1.53012 WP_000619389.1.53020 WP_000619389.1.53021 WP_000619389.1.53027 WP_000619389.1.53065 WP_000619389.1.53084 WP_000619389.1.53095 WP_000619389.1.53099 WP_000619389.1.5310 WP_000619389.1.53110 WP_000619389.1.53123 WP_000619389.1.53155 WP_000619389.1.53162 WP_000619389.1.53181 WP_000619389.1.53186 WP_000619389.1.532 WP_000619389.1.53211 WP_000619389.1.5322 WP_000619389.1.53223 WP_000619389.1.53228 WP_000619389.1.53238 WP_000619389.1.53242 WP_000619389.1.53244 WP_000619389.1.53251 WP_000619389.1.53252 WP_000619389.1.53262 WP_000619389.1.53277 WP_000619389.1.53308 WP_000619389.1.53327 WP_000619389.1.53356 WP_000619389.1.53360 WP_000619389.1.53364 WP_000619389.1.53377 WP_000619389.1.53401 WP_000619389.1.53410 WP_000619389.1.53415 WP_000619389.1.53419 WP_000619389.1.5342 WP_000619389.1.53428 WP_000619389.1.53431 WP_000619389.1.53482 WP_000619389.1.53505 WP_000619389.1.5351 WP_000619389.1.53535 WP_000619389.1.53537 WP_000619389.1.53545 WP_000619389.1.53556 WP_000619389.1.53557 WP_000619389.1.53574 WP_000619389.1.53582 WP_000619389.1.53587 WP_000619389.1.53589 WP_000619389.1.53592 WP_000619389.1.53594 WP_000619389.1.5362 WP_000619389.1.53642 WP_000619389.1.53645 WP_000619389.1.53649 WP_000619389.1.53687 WP_000619389.1.53690 WP_000619389.1.53693 WP_000619389.1.53706 WP_000619389.1.53769 WP_000619389.1.53809 WP_000619389.1.53810 WP_000619389.1.53811 WP_000619389.1.53841 WP_000619389.1.53845 WP_000619389.1.53863 WP_000619389.1.53866 WP_000619389.1.53878 WP_000619389.1.53884 WP_000619389.1.5391 WP_000619389.1.5393 WP_000619389.1.53931 WP_000619389.1.53940 WP_000619389.1.5395 WP_000619389.1.53966 WP_000619389.1.53968 WP_000619389.1.53972 WP_000619389.1.53978 WP_000619389.1.53991 WP_000619389.1.53994 WP_000619389.1.54002 WP_000619389.1.54013 WP_000619389.1.54023 WP_000619389.1.54024 WP_000619389.1.54028 WP_000619389.1.54032 WP_000619389.1.54051 WP_000619389.1.54072 WP_000619389.1.54091 WP_000619389.1.54095 WP_000619389.1.54102 WP_000619389.1.54104 WP_000619389.1.54144 WP_000619389.1.54169 WP_000619389.1.54185 WP_000619389.1.54188 WP_000619389.1.54202 WP_000619389.1.54208 WP_000619389.1.54213 WP_000619389.1.54263 WP_000619389.1.54307 WP_000619389.1.54317 WP_000619389.1.54328 WP_000619389.1.54329 WP_000619389.1.5433 WP_000619389.1.5434 WP_000619389.1.54344 WP_000619389.1.54359 WP_000619389.1.54388 WP_000619389.1.54394 WP_000619389.1.5440 WP_000619389.1.5441 WP_000619389.1.54411 WP_000619389.1.54417 WP_000619389.1.54418 WP_000619389.1.54429 WP_000619389.1.54439 WP_000619389.1.54454 WP_000619389.1.54463 WP_000619389.1.54476 WP_000619389.1.54507 WP_000619389.1.54524 WP_000619389.1.54534 WP_000619389.1.54546 WP_000619389.1.54585 WP_000619389.1.54590 WP_000619389.1.54591 WP_000619389.1.5460 WP_000619389.1.54601 WP_000619389.1.54602 WP_000619389.1.54605 WP_000619389.1.5461 WP_000619389.1.54614 WP_000619389.1.54617 WP_000619389.1.54620 WP_000619389.1.54625 WP_000619389.1.54638 WP_000619389.1.54641 WP_000619389.1.54643 WP_000619389.1.5467 WP_000619389.1.54688 WP_000619389.1.54695 WP_000619389.1.5470 WP_000619389.1.54708 WP_000619389.1.54725 WP_000619389.1.54754 WP_000619389.1.54755 WP_000619389.1.54760 WP_000619389.1.54769 WP_000619389.1.5478 WP_000619389.1.5479 WP_000619389.1.54798 WP_000619389.1.54817 WP_000619389.1.54829 WP_000619389.1.5486 WP_000619389.1.54875 WP_000619389.1.54883 WP_000619389.1.54918 WP_000619389.1.54921 WP_000619389.1.54927 WP_000619389.1.54940 WP_000619389.1.54941 WP_000619389.1.54946 WP_000619389.1.54972 WP_000619389.1.54981 WP_000619389.1.54989 WP_000619389.1.54991 WP_000619389.1.54993 WP_000619389.1.55003 WP_000619389.1.55005 WP_000619389.1.55009 WP_000619389.1.55041 WP_000619389.1.55070 WP_000619389.1.55112 WP_000619389.1.55115 WP_000619389.1.5512 WP_000619389.1.55123 WP_000619389.1.55134 WP_000619389.1.55144 WP_000619389.1.55149 WP_000619389.1.55151 WP_000619389.1.55177 WP_000619389.1.55179 WP_000619389.1.55185 WP_000619389.1.55197 WP_000619389.1.5520 WP_000619389.1.55203 WP_000619389.1.55218 WP_000619389.1.55222 WP_000619389.1.55226 WP_000619389.1.55273 WP_000619389.1.55275 WP_000619389.1.55286 WP_000619389.1.55291 WP_000619389.1.55338 WP_000619389.1.55342 WP_000619389.1.55357 WP_000619389.1.55359 WP_000619389.1.55374 WP_000619389.1.55381 WP_000619389.1.55417 WP_000619389.1.55420 WP_000619389.1.55424 WP_000619389.1.55425 WP_000619389.1.5546 WP_000619389.1.55466 WP_000619389.1.55472 WP_000619389.1.55482 WP_000619389.1.55483 WP_000619389.1.55489 WP_000619389.1.55492 WP_000619389.1.55507 WP_000619389.1.55529 WP_000619389.1.55550 WP_000619389.1.55551 WP_000619389.1.55552 WP_000619389.1.55556 WP_000619389.1.55560 WP_000619389.1.55563 WP_000619389.1.55571 WP_000619389.1.55574 WP_000619389.1.55581 WP_000619389.1.55597 WP_000619389.1.55608 WP_000619389.1.5561 WP_000619389.1.55629 WP_000619389.1.5566 WP_000619389.1.55676 WP_000619389.1.5570 WP_000619389.1.55709 WP_000619389.1.55720 WP_000619389.1.55727 WP_000619389.1.55730 WP_000619389.1.55731 WP_000619389.1.55744 WP_000619389.1.55757 WP_000619389.1.55787 WP_000619389.1.55790 WP_000619389.1.55791 WP_000619389.1.55808 WP_000619389.1.55820 WP_000619389.1.55825 WP_000619389.1.55838 WP_000619389.1.55844 WP_000619389.1.55868 WP_000619389.1.55870 WP_000619389.1.55888 WP_000619389.1.55892 WP_000619389.1.55897 WP_000619389.1.55936 WP_000619389.1.55979 WP_000619389.1.55981 WP_000619389.1.55988 WP_000619389.1.55990 WP_000619389.1.56033 WP_000619389.1.56040 WP_000619389.1.56047 WP_000619389.1.56072 WP_000619389.1.561 WP_000619389.1.56101 WP_000619389.1.56122 WP_000619389.1.56139 WP_000619389.1.5614 WP_000619389.1.56142 WP_000619389.1.56149 WP_000619389.1.56151 WP_000619389.1.5616 WP_000619389.1.56164 WP_000619389.1.56169 WP_000619389.1.56177 WP_000619389.1.56193 WP_000619389.1.56197 WP_000619389.1.562 WP_000619389.1.56216 WP_000619389.1.56231 WP_000619389.1.56278 WP_000619389.1.56285 WP_000619389.1.56293 WP_000619389.1.56302 WP_000619389.1.5632 WP_000619389.1.56338 WP_000619389.1.56345 WP_000619389.1.56358 WP_000619389.1.56371 WP_000619389.1.56388 WP_000619389.1.5639 WP_000619389.1.56390 WP_000619389.1.56392 WP_000619389.1.56399 WP_000619389.1.56402 WP_000619389.1.56436 WP_000619389.1.56439 WP_000619389.1.56446 WP_000619389.1.56457 WP_000619389.1.5646 WP_000619389.1.56469 WP_000619389.1.56481 WP_000619389.1.56489 WP_000619389.1.5649 WP_000619389.1.56491 WP_000619389.1.56501 WP_000619389.1.56502 WP_000619389.1.56513 WP_000619389.1.56523 WP_000619389.1.56528 WP_000619389.1.56543 WP_000619389.1.56554 WP_000619389.1.56571 WP_000619389.1.56573 WP_000619389.1.56586 WP_000619389.1.56650 WP_000619389.1.56662 WP_000619389.1.56665 WP_000619389.1.56680 WP_000619389.1.56689 WP_000619389.1.5670 WP_000619389.1.56704 WP_000619389.1.56713 WP_000619389.1.56714 WP_000619389.1.56721 WP_000619389.1.56742 WP_000619389.1.56776 WP_000619389.1.56777 WP_000619389.1.56786 WP_000619389.1.56787 WP_000619389.1.56789 WP_000619389.1.56799 WP_000619389.1.56821 WP_000619389.1.56830 WP_000619389.1.56835 WP_000619389.1.56846 WP_000619389.1.5685 WP_000619389.1.56871 WP_000619389.1.56882 WP_000619389.1.56885 WP_000619389.1.56908 WP_000619389.1.56932 WP_000619389.1.56933 WP_000619389.1.56934 WP_000619389.1.56936 WP_000619389.1.56937 WP_000619389.1.56941 WP_000619389.1.56951 WP_000619389.1.56978 WP_000619389.1.56992 WP_000619389.1.57011 WP_000619389.1.57032 WP_000619389.1.57045 WP_000619389.1.57051 WP_000619389.1.57068 WP_000619389.1.57071 WP_000619389.1.57072 WP_000619389.1.57079 WP_000619389.1.57086 WP_000619389.1.57100 WP_000619389.1.57124 WP_000619389.1.57150 WP_000619389.1.57159 WP_000619389.1.57180 WP_000619389.1.57181 WP_000619389.1.57182 WP_000619389.1.57185 WP_000619389.1.57202 WP_000619389.1.57213 WP_000619389.1.57216 WP_000619389.1.57222 WP_000619389.1.57254 WP_000619389.1.57266 WP_000619389.1.57269 WP_000619389.1.57278 WP_000619389.1.57280 WP_000619389.1.57281 WP_000619389.1.57319 WP_000619389.1.57348 WP_000619389.1.57349 WP_000619389.1.57386 WP_000619389.1.57395 WP_000619389.1.57401 WP_000619389.1.57403 WP_000619389.1.57410 WP_000619389.1.57414 WP_000619389.1.5742 WP_000619389.1.57432 WP_000619389.1.57438 WP_000619389.1.57451 WP_000619389.1.57453 WP_000619389.1.57466 WP_000619389.1.5748 WP_000619389.1.57487 WP_000619389.1.57492 WP_000619389.1.57517 WP_000619389.1.57538 WP_000619389.1.57539 WP_000619389.1.5755 WP_000619389.1.57550 WP_000619389.1.57558 WP_000619389.1.57574 WP_000619389.1.57588 WP_000619389.1.57608 WP_000619389.1.57610 WP_000619389.1.57628 WP_000619389.1.57629 WP_000619389.1.57634 WP_000619389.1.57638 WP_000619389.1.5764 WP_000619389.1.57646 WP_000619389.1.57659 WP_000619389.1.57663 WP_000619389.1.57719 WP_000619389.1.57738 WP_000619389.1.57812 WP_000619389.1.57814 WP_000619389.1.57832 WP_000619389.1.57836 WP_000619389.1.57846 WP_000619389.1.57851 WP_000619389.1.57854 WP_000619389.1.5786 WP_000619389.1.5787 WP_000619389.1.57898 WP_000619389.1.57903 WP_000619389.1.57904 WP_000619389.1.57920 WP_000619389.1.57951 WP_000619389.1.57975 WP_000619389.1.57982 WP_000619389.1.57983 WP_000619389.1.57994 WP_000619389.1.58001 WP_000619389.1.58009 WP_000619389.1.58022 WP_000619389.1.58038 WP_000619389.1.58045 WP_000619389.1.58048 WP_000619389.1.58057 WP_000619389.1.58060 WP_000619389.1.58080 WP_000619389.1.58092 WP_000619389.1.58094 WP_000619389.1.58097 WP_000619389.1.58098 WP_000619389.1.5810 WP_000619389.1.58107 WP_000619389.1.5812 WP_000619389.1.58128 WP_000619389.1.58136 WP_000619389.1.58143 WP_000619389.1.58146 WP_000619389.1.58163 WP_000619389.1.58169 WP_000619389.1.58172 WP_000619389.1.58206 WP_000619389.1.58226 WP_000619389.1.58232 WP_000619389.1.58233 WP_000619389.1.58238 WP_000619389.1.58244 WP_000619389.1.58248 WP_000619389.1.58267 WP_000619389.1.58289 WP_000619389.1.58292 WP_000619389.1.58316 WP_000619389.1.58336 WP_000619389.1.58340 WP_000619389.1.58345 WP_000619389.1.58368 WP_000619389.1.58371 WP_000619389.1.58384 WP_000619389.1.584 WP_000619389.1.58401 WP_000619389.1.58408 WP_000619389.1.58414 WP_000619389.1.5842 WP_000619389.1.58420 WP_000619389.1.58423 WP_000619389.1.58424 WP_000619389.1.58429 WP_000619389.1.58440 WP_000619389.1.58444 WP_000619389.1.58445 WP_000619389.1.58449 WP_000619389.1.58459 WP_000619389.1.58475 WP_000619389.1.58484 WP_000619389.1.58493 WP_000619389.1.58496 WP_000619389.1.585 WP_000619389.1.58507 WP_000619389.1.58514 WP_000619389.1.5852 WP_000619389.1.58528 WP_000619389.1.58547 WP_000619389.1.58552 WP_000619389.1.58560 WP_000619389.1.58572 WP_000619389.1.58582 WP_000619389.1.58609 WP_000619389.1.58617 WP_000619389.1.58622 WP_000619389.1.58657 WP_000619389.1.58680 WP_000619389.1.58692 WP_000619389.1.58705 WP_000619389.1.58707 WP_000619389.1.58723 WP_000619389.1.58737 WP_000619389.1.58799 WP_000619389.1.58837 WP_000619389.1.58867 WP_000619389.1.58870 WP_000619389.1.58901 WP_000619389.1.58940 WP_000619389.1.58942 WP_000619389.1.58951 WP_000619389.1.58958 WP_000619389.1.58976 WP_000619389.1.58977 WP_000619389.1.58983 WP_000619389.1.58999 WP_000619389.1.59024 WP_000619389.1.59026 WP_000619389.1.59035 WP_000619389.1.59038 WP_000619389.1.59055 WP_000619389.1.5906 WP_000619389.1.59060 WP_000619389.1.59073 WP_000619389.1.59083 WP_000619389.1.59119 WP_000619389.1.59165 WP_000619389.1.59174 WP_000619389.1.59190 WP_000619389.1.59199 WP_000619389.1.59218 WP_000619389.1.59226 WP_000619389.1.59263 WP_000619389.1.5927 WP_000619389.1.59280 WP_000619389.1.59291 WP_000619389.1.59292 WP_000619389.1.59293 WP_000619389.1.59302 WP_000619389.1.59306 WP_000619389.1.59359 WP_000619389.1.59374 WP_000619389.1.59395 WP_000619389.1.59396 WP_000619389.1.59407 WP_000619389.1.59409 WP_000619389.1.59413 WP_000619389.1.5942 WP_000619389.1.59423 WP_000619389.1.59425 WP_000619389.1.59426 WP_000619389.1.59434 WP_000619389.1.59470 WP_000619389.1.59483 WP_000619389.1.59491 WP_000619389.1.59513 WP_000619389.1.59533 WP_000619389.1.59553 WP_000619389.1.59572 WP_000619389.1.59577 WP_000619389.1.59579 WP_000619389.1.59590 WP_000619389.1.59611 WP_000619389.1.59613 WP_000619389.1.59615 WP_000619389.1.59621 WP_000619389.1.5963 WP_000619389.1.59638 WP_000619389.1.5965 WP_000619389.1.59660 WP_000619389.1.59679 WP_000619389.1.59689 WP_000619389.1.59699 WP_000619389.1.597 WP_000619389.1.59714 WP_000619389.1.59717 WP_000619389.1.59730 WP_000619389.1.59733 WP_000619389.1.59737 WP_000619389.1.59745 WP_000619389.1.59748 WP_000619389.1.59756 WP_000619389.1.59781 WP_000619389.1.59782 WP_000619389.1.59788 WP_000619389.1.59791 WP_000619389.1.59793 WP_000619389.1.59815 WP_000619389.1.59823 WP_000619389.1.59836 WP_000619389.1.59838 WP_000619389.1.59853 WP_000619389.1.59855 WP_000619389.1.59858 WP_000619389.1.59877 WP_000619389.1.59894 WP_000619389.1.5990 WP_000619389.1.59900 WP_000619389.1.59905 WP_000619389.1.59912 WP_000619389.1.59914 WP_000619389.1.59931 WP_000619389.1.59932 WP_000619389.1.59959 WP_000619389.1.59970 WP_000619389.1.59980 WP_000619389.1.59981 WP_000619389.1.59989 WP_000619389.1.59998 WP_000619389.1.60005 WP_000619389.1.6002 WP_000619389.1.60023 WP_000619389.1.60031 WP_000619389.1.60042 WP_000619389.1.60043 WP_000619389.1.60048 WP_000619389.1.60067 WP_000619389.1.60070 WP_000619389.1.60095 WP_000619389.1.60096 WP_000619389.1.60110 WP_000619389.1.60117 WP_000619389.1.6013 WP_000619389.1.60133 WP_000619389.1.60186 WP_000619389.1.6022 WP_000619389.1.60225 WP_000619389.1.60228 WP_000619389.1.60235 WP_000619389.1.60246 WP_000619389.1.60304 WP_000619389.1.60325 WP_000619389.1.60337 WP_000619389.1.60342 WP_000619389.1.60343 WP_000619389.1.60350 WP_000619389.1.60373 WP_000619389.1.60374 WP_000619389.1.60387 WP_000619389.1.60411 WP_000619389.1.60436 WP_000619389.1.60443 WP_000619389.1.60453 WP_000619389.1.60457 WP_000619389.1.60461 WP_000619389.1.60477 WP_000619389.1.60491 WP_000619389.1.60498 WP_000619389.1.60505 WP_000619389.1.60544 WP_000619389.1.60550 WP_000619389.1.60555 WP_000619389.1.60559 WP_000619389.1.60567 WP_000619389.1.60570 WP_000619389.1.60576 WP_000619389.1.6059 WP_000619389.1.60591 WP_000619389.1.60599 WP_000619389.1.60606 WP_000619389.1.6061 WP_000619389.1.60613 WP_000619389.1.60614 WP_000619389.1.60630 WP_000619389.1.6064 WP_000619389.1.60644 WP_000619389.1.60647 WP_000619389.1.60654 WP_000619389.1.6066 WP_000619389.1.60671 WP_000619389.1.6068 WP_000619389.1.60684 WP_000619389.1.60698 WP_000619389.1.60717 WP_000619389.1.60732 WP_000619389.1.60744 WP_000619389.1.60761 WP_000619389.1.60764 WP_000619389.1.60771 WP_000619389.1.60784 WP_000619389.1.60805 WP_000619389.1.60816 WP_000619389.1.60826 WP_000619389.1.60832 WP_000619389.1.60835 WP_000619389.1.60847 WP_000619389.1.60872 WP_000619389.1.60895 WP_000619389.1.60901 WP_000619389.1.60921 WP_000619389.1.60925 WP_000619389.1.60927 WP_000619389.1.60935 WP_000619389.1.6094 WP_000619389.1.60974 WP_000619389.1.61005 WP_000619389.1.61006 WP_000619389.1.61035 WP_000619389.1.61039 WP_000619389.1.61046 WP_000619389.1.61058 WP_000619389.1.6106 WP_000619389.1.61096 WP_000619389.1.61097 WP_000619389.1.61099 WP_000619389.1.6110 WP_000619389.1.61102 WP_000619389.1.61108 WP_000619389.1.61112 WP_000619389.1.61121 WP_000619389.1.61132 WP_000619389.1.61148 WP_000619389.1.61170 WP_000619389.1.61174 WP_000619389.1.61175 WP_000619389.1.61183 WP_000619389.1.61186 WP_000619389.1.61223 WP_000619389.1.61225 WP_000619389.1.61241 WP_000619389.1.61245 WP_000619389.1.61253 WP_000619389.1.61268 WP_000619389.1.61284 WP_000619389.1.61292 WP_000619389.1.613 WP_000619389.1.61360 WP_000619389.1.61362 WP_000619389.1.61364 WP_000619389.1.61373 WP_000619389.1.61398 WP_000619389.1.61442 WP_000619389.1.61445 WP_000619389.1.61480 WP_000619389.1.61496 WP_000619389.1.615 WP_000619389.1.61505 WP_000619389.1.61512 WP_000619389.1.61517 WP_000619389.1.61524 WP_000619389.1.61551 WP_000619389.1.61608 WP_000619389.1.61612 WP_000619389.1.61617 WP_000619389.1.61623 WP_000619389.1.61636 WP_000619389.1.61643 WP_000619389.1.61663 WP_000619389.1.61703 WP_000619389.1.61718 WP_000619389.1.61739 WP_000619389.1.61758 WP_000619389.1.61770 WP_000619389.1.61772 WP_000619389.1.61779 WP_000619389.1.61789 WP_000619389.1.618 WP_000619389.1.61806 WP_000619389.1.61822 WP_000619389.1.61835 WP_000619389.1.61853 WP_000619389.1.61858 WP_000619389.1.61874 WP_000619389.1.61893 WP_000619389.1.61926 WP_000619389.1.61939 WP_000619389.1.61948 WP_000619389.1.61949 WP_000619389.1.61957 WP_000619389.1.61966 WP_000619389.1.61985 WP_000619389.1.62015 WP_000619389.1.62038 WP_000619389.1.62041 WP_000619389.1.62043 WP_000619389.1.62091 WP_000619389.1.62099 WP_000619389.1.62102 WP_000619389.1.6212 WP_000619389.1.62135 WP_000619389.1.62157 WP_000619389.1.62182 WP_000619389.1.62207 WP_000619389.1.62236 WP_000619389.1.62262 WP_000619389.1.62264 WP_000619389.1.62266 WP_000619389.1.62273 WP_000619389.1.62282 WP_000619389.1.62290 WP_000619389.1.62296 WP_000619389.1.62303 WP_000619389.1.62322 WP_000619389.1.62337 WP_000619389.1.62348 WP_000619389.1.62358 WP_000619389.1.62424 WP_000619389.1.62447 WP_000619389.1.6245 WP_000619389.1.62454 WP_000619389.1.62460 WP_000619389.1.62480 WP_000619389.1.62481 WP_000619389.1.62487 WP_000619389.1.62503 WP_000619389.1.62507 WP_000619389.1.62513 WP_000619389.1.62514 WP_000619389.1.62529 WP_000619389.1.62541 WP_000619389.1.62555 WP_000619389.1.62586 WP_000619389.1.6261 WP_000619389.1.62612 WP_000619389.1.62631 WP_000619389.1.62642 WP_000619389.1.62646 WP_000619389.1.62668 WP_000619389.1.62675 WP_000619389.1.62681 WP_000619389.1.62714 WP_000619389.1.62735 WP_000619389.1.62750 WP_000619389.1.62762 WP_000619389.1.62769 WP_000619389.1.62780 WP_000619389.1.62784 WP_000619389.1.62787 WP_000619389.1.62788 WP_000619389.1.62802 WP_000619389.1.62812 WP_000619389.1.62818 WP_000619389.1.62819 WP_000619389.1.6282 WP_000619389.1.62840 WP_000619389.1.62843 WP_000619389.1.62850 WP_000619389.1.62851 WP_000619389.1.62866 WP_000619389.1.62885 WP_000619389.1.62888 WP_000619389.1.62914 WP_000619389.1.62919 WP_000619389.1.6293 WP_000619389.1.62931 WP_000619389.1.62951 WP_000619389.1.62959 WP_000619389.1.62973 WP_000619389.1.62989 WP_000619389.1.6299 WP_000619389.1.62992 WP_000619389.1.63023 WP_000619389.1.6307 WP_000619389.1.63078 WP_000619389.1.63113 WP_000619389.1.63167 WP_000619389.1.63177 WP_000619389.1.63189 WP_000619389.1.6323 WP_000619389.1.63246 WP_000619389.1.63271 WP_000619389.1.63285 WP_000619389.1.63287 WP_000619389.1.63305 WP_000619389.1.6331 WP_000619389.1.63310 WP_000619389.1.63330 WP_000619389.1.6334 WP_000619389.1.63350 WP_000619389.1.6337 WP_000619389.1.63370 WP_000619389.1.63374 WP_000619389.1.63393 WP_000619389.1.63419 WP_000619389.1.63433 WP_000619389.1.63435 WP_000619389.1.63437 WP_000619389.1.63444 WP_000619389.1.63445 WP_000619389.1.63453 WP_000619389.1.63465 WP_000619389.1.63466 WP_000619389.1.63467 WP_000619389.1.63470 WP_000619389.1.63478 WP_000619389.1.6348 WP_000619389.1.63484 WP_000619389.1.63487 WP_000619389.1.63491 WP_000619389.1.63496 WP_000619389.1.63536 WP_000619389.1.63554 WP_000619389.1.63556 WP_000619389.1.63563 WP_000619389.1.63576 WP_000619389.1.63586 WP_000619389.1.63602 WP_000619389.1.63604 WP_000619389.1.63608 WP_000619389.1.63612 WP_000619389.1.63615 WP_000619389.1.6364 WP_000619389.1.63666 WP_000619389.1.63679 WP_000619389.1.63683 WP_000619389.1.63703 WP_000619389.1.63746 WP_000619389.1.63800 WP_000619389.1.63810 WP_000619389.1.63814 WP_000619389.1.63821 WP_000619389.1.63856 WP_000619389.1.63871 WP_000619389.1.63872 WP_000619389.1.63957 WP_000619389.1.63964 WP_000619389.1.63969 WP_000619389.1.63990 WP_000619389.1.64008 WP_000619389.1.64014 WP_000619389.1.64030 WP_000619389.1.64040 WP_000619389.1.64045 WP_000619389.1.64050 WP_000619389.1.64053 WP_000619389.1.64074 WP_000619389.1.64080 WP_000619389.1.64086 WP_000619389.1.64110 WP_000619389.1.64138 WP_000619389.1.64150 WP_000619389.1.64153 WP_000619389.1.6416 WP_000619389.1.64161 WP_000619389.1.64165 WP_000619389.1.64175 WP_000619389.1.64180 WP_000619389.1.64190 WP_000619389.1.64193 WP_000619389.1.64280 WP_000619389.1.64285 WP_000619389.1.64286 WP_000619389.1.643 WP_000619389.1.6431 WP_000619389.1.64312 WP_000619389.1.64321 WP_000619389.1.64330 WP_000619389.1.64337 WP_000619389.1.64353 WP_000619389.1.64355 WP_000619389.1.64356 WP_000619389.1.64371 WP_000619389.1.64380 WP_000619389.1.64391 WP_000619389.1.6441 WP_000619389.1.64417 WP_000619389.1.64437 WP_000619389.1.64438 WP_000619389.1.6444 WP_000619389.1.64448 WP_000619389.1.6445 WP_000619389.1.64458 WP_000619389.1.6446 WP_000619389.1.64519 WP_000619389.1.64520 WP_000619389.1.64528 WP_000619389.1.64540 WP_000619389.1.64547 WP_000619389.1.64563 WP_000619389.1.64621 WP_000619389.1.64634 WP_000619389.1.64657 WP_000619389.1.64670 WP_000619389.1.6469 WP_000619389.1.64693 WP_000619389.1.64695 WP_000619389.1.647 WP_000619389.1.64707 WP_000619389.1.64746 WP_000619389.1.64749 WP_000619389.1.64784 WP_000619389.1.64789 WP_000619389.1.64793 WP_000619389.1.64821 WP_000619389.1.64840 WP_000619389.1.64866 WP_000619389.1.64875 WP_000619389.1.64881 WP_000619389.1.64895 WP_000619389.1.64901 WP_000619389.1.64912 WP_000619389.1.64926 WP_000619389.1.64930 WP_000619389.1.64939 WP_000619389.1.64946 WP_000619389.1.64970 WP_000619389.1.64990 WP_000619389.1.6500 WP_000619389.1.65023 WP_000619389.1.65035 WP_000619389.1.65040 WP_000619389.1.65056 WP_000619389.1.65061 WP_000619389.1.65084 WP_000619389.1.65085 WP_000619389.1.65097 WP_000619389.1.651 WP_000619389.1.65104 WP_000619389.1.6511 WP_000619389.1.65110 WP_000619389.1.65114 WP_000619389.1.65116 WP_000619389.1.65118 WP_000619389.1.65122 WP_000619389.1.65135 WP_000619389.1.65151 WP_000619389.1.65155 WP_000619389.1.6516 WP_000619389.1.65179 WP_000619389.1.65192 WP_000619389.1.65194 WP_000619389.1.65206 WP_000619389.1.65240 WP_000619389.1.65256 WP_000619389.1.65271 WP_000619389.1.65286 WP_000619389.1.65296 WP_000619389.1.65305 WP_000619389.1.65306 WP_000619389.1.65353 WP_000619389.1.65355 WP_000619389.1.65364 WP_000619389.1.65366 WP_000619389.1.6537 WP_000619389.1.65370 WP_000619389.1.65372 WP_000619389.1.654 WP_000619389.1.65405 WP_000619389.1.65408 WP_000619389.1.65413 WP_000619389.1.65415 WP_000619389.1.65456 WP_000619389.1.65484 WP_000619389.1.65493 WP_000619389.1.6553 WP_000619389.1.65531 WP_000619389.1.65546 WP_000619389.1.65565 WP_000619389.1.65571 WP_000619389.1.65581 WP_000619389.1.65596 WP_000619389.1.65606 WP_000619389.1.6563 WP_000619389.1.65662 WP_000619389.1.65667 WP_000619389.1.65672 WP_000619389.1.65677 WP_000619389.1.65708 WP_000619389.1.65714 WP_000619389.1.65749 WP_000619389.1.6576 WP_000619389.1.65762 WP_000619389.1.65834 WP_000619389.1.6587 WP_000619389.1.65875 WP_000619389.1.65898 WP_000619389.1.65912 WP_000619389.1.65954 WP_000619389.1.65957 WP_000619389.1.65961 WP_000619389.1.65962 WP_000619389.1.65963 WP_000619389.1.65976 WP_000619389.1.65978 WP_000619389.1.65988 WP_000619389.1.6599 WP_000619389.1.65991 WP_000619389.1.66001 WP_000619389.1.66007 WP_000619389.1.66016 WP_000619389.1.66017 WP_000619389.1.66022 WP_000619389.1.66033 WP_000619389.1.6604 WP_000619389.1.66044 WP_000619389.1.66050 WP_000619389.1.66059 WP_000619389.1.66071 WP_000619389.1.6609 WP_000619389.1.66094 WP_000619389.1.66100 WP_000619389.1.66102 WP_000619389.1.66104 WP_000619389.1.66105 WP_000619389.1.66121 WP_000619389.1.66127 WP_000619389.1.66161 WP_000619389.1.6618 WP_000619389.1.66181 WP_000619389.1.66197 WP_000619389.1.6622 WP_000619389.1.66255 WP_000619389.1.66264 WP_000619389.1.66280 WP_000619389.1.66288 WP_000619389.1.66290 WP_000619389.1.66295 WP_000619389.1.66327 WP_000619389.1.66335 WP_000619389.1.6635 WP_000619389.1.66376 WP_000619389.1.66387 WP_000619389.1.66389 WP_000619389.1.66392 WP_000619389.1.66395 WP_000619389.1.66412 WP_000619389.1.66421 WP_000619389.1.66432 WP_000619389.1.66448 WP_000619389.1.6645 WP_000619389.1.66501 WP_000619389.1.66511 WP_000619389.1.66523 WP_000619389.1.66531 WP_000619389.1.6654 WP_000619389.1.66550 WP_000619389.1.66559 WP_000619389.1.66566 WP_000619389.1.66579 WP_000619389.1.66624 WP_000619389.1.66644 WP_000619389.1.6665 WP_000619389.1.6666 WP_000619389.1.66667 WP_000619389.1.66668 WP_000619389.1.66700 WP_000619389.1.66706 WP_000619389.1.66708 WP_000619389.1.66719 WP_000619389.1.66727 WP_000619389.1.66751 WP_000619389.1.66758 WP_000619389.1.6676 WP_000619389.1.66783 WP_000619389.1.66787 WP_000619389.1.66791 WP_000619389.1.66794 WP_000619389.1.66795 WP_000619389.1.66796 WP_000619389.1.66849 WP_000619389.1.66873 WP_000619389.1.66922 WP_000619389.1.66926 WP_000619389.1.66933 WP_000619389.1.66948 WP_000619389.1.66975 WP_000619389.1.66978 WP_000619389.1.6698 WP_000619389.1.66984 WP_000619389.1.6701 WP_000619389.1.67018 WP_000619389.1.67021 WP_000619389.1.67022 WP_000619389.1.67026 WP_000619389.1.67029 WP_000619389.1.67035 WP_000619389.1.67047 WP_000619389.1.67055 WP_000619389.1.6706 WP_000619389.1.67073 WP_000619389.1.67102 WP_000619389.1.67116 WP_000619389.1.67120 WP_000619389.1.67132 WP_000619389.1.67136 WP_000619389.1.67137 WP_000619389.1.67149 WP_000619389.1.67150 WP_000619389.1.67153 WP_000619389.1.67158 WP_000619389.1.67164 WP_000619389.1.67174 WP_000619389.1.67193 WP_000619389.1.67194 WP_000619389.1.67200 WP_000619389.1.67209 WP_000619389.1.67210 WP_000619389.1.67214 WP_000619389.1.6723 WP_000619389.1.67258 WP_000619389.1.67272 WP_000619389.1.67278 WP_000619389.1.67284 WP_000619389.1.67293 WP_000619389.1.6735 WP_000619389.1.67373 WP_000619389.1.67383 WP_000619389.1.67412 WP_000619389.1.67415 WP_000619389.1.67427 WP_000619389.1.67446 WP_000619389.1.67451 WP_000619389.1.67452 WP_000619389.1.67454 WP_000619389.1.67456 WP_000619389.1.67462 WP_000619389.1.67464 WP_000619389.1.67467 WP_000619389.1.67468 WP_000619389.1.67495 WP_000619389.1.67522 WP_000619389.1.67533 WP_000619389.1.67538 WP_000619389.1.67549 WP_000619389.1.67553 WP_000619389.1.67581 WP_000619389.1.67590 WP_000619389.1.67606 WP_000619389.1.67660 WP_000619389.1.67663 WP_000619389.1.67669 WP_000619389.1.67676 WP_000619389.1.67681 WP_000619389.1.67685 WP_000619389.1.6769 WP_000619389.1.67690 WP_000619389.1.67701 WP_000619389.1.67704 WP_000619389.1.67724 WP_000619389.1.67726 WP_000619389.1.67732 WP_000619389.1.67737 WP_000619389.1.67753 WP_000619389.1.67758 WP_000619389.1.67760 WP_000619389.1.67775 WP_000619389.1.67780 WP_000619389.1.67786 WP_000619389.1.67787 WP_000619389.1.67788 WP_000619389.1.678 WP_000619389.1.67802 WP_000619389.1.67810 WP_000619389.1.67841 WP_000619389.1.67853 WP_000619389.1.67861 WP_000619389.1.67891 WP_000619389.1.67894 WP_000619389.1.67901 WP_000619389.1.6793 WP_000619389.1.67938 WP_000619389.1.67971 WP_000619389.1.67975 WP_000619389.1.67984 WP_000619389.1.67990 WP_000619389.1.67992 WP_000619389.1.67999 WP_000619389.1.68008 WP_000619389.1.68011 WP_000619389.1.68012 WP_000619389.1.6802 WP_000619389.1.68025 WP_000619389.1.6803 WP_000619389.1.68039 WP_000619389.1.68052 WP_000619389.1.68053 WP_000619389.1.68058 WP_000619389.1.68059 WP_000619389.1.68063 WP_000619389.1.68067 WP_000619389.1.68069 WP_000619389.1.68070 WP_000619389.1.68071 WP_000619389.1.68079 WP_000619389.1.68096 WP_000619389.1.6810 WP_000619389.1.68108 WP_000619389.1.68126 WP_000619389.1.68138 WP_000619389.1.6814 WP_000619389.1.68145 WP_000619389.1.68157 WP_000619389.1.68170 WP_000619389.1.68175 WP_000619389.1.68177 WP_000619389.1.682 WP_000619389.1.68200 WP_000619389.1.68215 WP_000619389.1.68231 WP_000619389.1.68241 WP_000619389.1.68255 WP_000619389.1.68271 WP_000619389.1.68278 WP_000619389.1.68279 WP_000619389.1.68281 WP_000619389.1.68283 WP_000619389.1.68292 WP_000619389.1.68300 WP_000619389.1.68336 WP_000619389.1.68341 WP_000619389.1.68347 WP_000619389.1.68362 WP_000619389.1.68369 WP_000619389.1.68372 WP_000619389.1.68395 WP_000619389.1.68396 WP_000619389.1.68411 WP_000619389.1.68441 WP_000619389.1.68442 WP_000619389.1.68482 WP_000619389.1.68490 WP_000619389.1.68493 WP_000619389.1.68523 WP_000619389.1.68524 WP_000619389.1.68566 WP_000619389.1.68572 WP_000619389.1.68584 WP_000619389.1.6859 WP_000619389.1.68598 WP_000619389.1.6860 WP_000619389.1.68609 WP_000619389.1.68630 WP_000619389.1.68632 WP_000619389.1.68635 WP_000619389.1.68673 WP_000619389.1.68678 WP_000619389.1.68679 WP_000619389.1.68695 WP_000619389.1.68697 WP_000619389.1.68701 WP_000619389.1.68711 WP_000619389.1.68731 WP_000619389.1.68735 WP_000619389.1.68750 WP_000619389.1.68751 WP_000619389.1.68752 WP_000619389.1.6877 WP_000619389.1.68795 WP_000619389.1.68797 WP_000619389.1.6880 WP_000619389.1.68801 WP_000619389.1.68838 WP_000619389.1.68847 WP_000619389.1.68865 WP_000619389.1.6887 WP_000619389.1.68873 WP_000619389.1.68877 WP_000619389.1.68880 WP_000619389.1.68911 WP_000619389.1.68915 WP_000619389.1.6892 WP_000619389.1.68924 WP_000619389.1.68936 WP_000619389.1.68942 WP_000619389.1.68952 WP_000619389.1.68956 WP_000619389.1.68961 WP_000619389.1.6897 WP_000619389.1.68989 WP_000619389.1.68995 WP_000619389.1.69033 WP_000619389.1.69039 WP_000619389.1.69054 WP_000619389.1.69098 WP_000619389.1.69126 WP_000619389.1.69127 WP_000619389.1.69144 WP_000619389.1.69158 WP_000619389.1.6916 WP_000619389.1.69160 WP_000619389.1.6919 WP_000619389.1.69192 WP_000619389.1.6921 WP_000619389.1.69221 WP_000619389.1.69247 WP_000619389.1.69258 WP_000619389.1.69261 WP_000619389.1.6929 WP_000619389.1.69303 WP_000619389.1.69305 WP_000619389.1.69327 WP_000619389.1.69341 WP_000619389.1.69350 WP_000619389.1.69351 WP_000619389.1.69382 WP_000619389.1.69390 WP_000619389.1.694 WP_000619389.1.69404 WP_000619389.1.69438 WP_000619389.1.69441 WP_000619389.1.6945 WP_000619389.1.69450 WP_000619389.1.69472 WP_000619389.1.69473 WP_000619389.1.69502 WP_000619389.1.69506 WP_000619389.1.69537 WP_000619389.1.69551 WP_000619389.1.69569 WP_000619389.1.69583 WP_000619389.1.69589 WP_000619389.1.69593 WP_000619389.1.69596 WP_000619389.1.69605 WP_000619389.1.69643 WP_000619389.1.69646 WP_000619389.1.69649 WP_000619389.1.69655 WP_000619389.1.69689 WP_000619389.1.697 WP_000619389.1.69716 WP_000619389.1.69730 WP_000619389.1.69735 WP_000619389.1.69780 WP_000619389.1.69786 WP_000619389.1.69803 WP_000619389.1.69810 WP_000619389.1.69818 WP_000619389.1.69831 WP_000619389.1.69832 WP_000619389.1.69868 WP_000619389.1.69872 WP_000619389.1.69887 WP_000619389.1.69896 WP_000619389.1.6993 WP_000619389.1.69963 WP_000619389.1.69972 WP_000619389.1.69979 WP_000619389.1.69999 WP_000619389.1.7001 WP_000619389.1.70041 WP_000619389.1.70063 WP_000619389.1.70081 WP_000619389.1.701 WP_000619389.1.70123 WP_000619389.1.70125 WP_000619389.1.7013 WP_000619389.1.70149 WP_000619389.1.7015 WP_000619389.1.70190 WP_000619389.1.70191 WP_000619389.1.70200 WP_000619389.1.70213 WP_000619389.1.70230 WP_000619389.1.70251 WP_000619389.1.70256 WP_000619389.1.70264 WP_000619389.1.70299 WP_000619389.1.70300 WP_000619389.1.70337 WP_000619389.1.70341 WP_000619389.1.70357 WP_000619389.1.70370 WP_000619389.1.70386 WP_000619389.1.70407 WP_000619389.1.70408 WP_000619389.1.70414 WP_000619389.1.70477 WP_000619389.1.70492 WP_000619389.1.7050 WP_000619389.1.70509 WP_000619389.1.70517 WP_000619389.1.7052 WP_000619389.1.70530 WP_000619389.1.70539 WP_000619389.1.70563 WP_000619389.1.70576 WP_000619389.1.70578 WP_000619389.1.70582 WP_000619389.1.70592 WP_000619389.1.70597 WP_000619389.1.70600 WP_000619389.1.70619 WP_000619389.1.70628 WP_000619389.1.70655 WP_000619389.1.70656 WP_000619389.1.70686 WP_000619389.1.70694 WP_000619389.1.70698 WP_000619389.1.70705 WP_000619389.1.70713 WP_000619389.1.70723 WP_000619389.1.70728 WP_000619389.1.70745 WP_000619389.1.70747 WP_000619389.1.70748 WP_000619389.1.70767 WP_000619389.1.70787 WP_000619389.1.70794 WP_000619389.1.70801 WP_000619389.1.70803 WP_000619389.1.70880 WP_000619389.1.70896 WP_000619389.1.7090 WP_000619389.1.70900 WP_000619389.1.70952 WP_000619389.1.70967 WP_000619389.1.71003 WP_000619389.1.7102 WP_000619389.1.71024 WP_000619389.1.71037 WP_000619389.1.71042 WP_000619389.1.71062 WP_000619389.1.71099 WP_000619389.1.71109 WP_000619389.1.71113 WP_000619389.1.71134 WP_000619389.1.71139 WP_000619389.1.71144 WP_000619389.1.71147 WP_000619389.1.71149 WP_000619389.1.71158 WP_000619389.1.71159 WP_000619389.1.71162 WP_000619389.1.71170 WP_000619389.1.71176 WP_000619389.1.71183 WP_000619389.1.71192 WP_000619389.1.71199 WP_000619389.1.71205 WP_000619389.1.7121 WP_000619389.1.71221 WP_000619389.1.71223 WP_000619389.1.71225 WP_000619389.1.71226 WP_000619389.1.71229 WP_000619389.1.71264 WP_000619389.1.71269 WP_000619389.1.71272 WP_000619389.1.71273 WP_000619389.1.71275 WP_000619389.1.71287 WP_000619389.1.71294 WP_000619389.1.71311 WP_000619389.1.71312 WP_000619389.1.71315 WP_000619389.1.71323 WP_000619389.1.71327 WP_000619389.1.71339 WP_000619389.1.71354 WP_000619389.1.71397 WP_000619389.1.71403 WP_000619389.1.71405 WP_000619389.1.71409 WP_000619389.1.71421 WP_000619389.1.71423 WP_000619389.1.71448 WP_000619389.1.7147 WP_000619389.1.71480 WP_000619389.1.71522 WP_000619389.1.71533 WP_000619389.1.71537 WP_000619389.1.71538 WP_000619389.1.71540 WP_000619389.1.71560 WP_000619389.1.71562 WP_000619389.1.71563 WP_000619389.1.71603 WP_000619389.1.71607 WP_000619389.1.71632 WP_000619389.1.71680 WP_000619389.1.71690 WP_000619389.1.71695 WP_000619389.1.71712 WP_000619389.1.71724 WP_000619389.1.71732 WP_000619389.1.71757 WP_000619389.1.71767 WP_000619389.1.71783 WP_000619389.1.71830 WP_000619389.1.71832 WP_000619389.1.71837 WP_000619389.1.71840 WP_000619389.1.71855 WP_000619389.1.71856 WP_000619389.1.71874 WP_000619389.1.71912 WP_000619389.1.7192 WP_000619389.1.71922 WP_000619389.1.71938 WP_000619389.1.71939 WP_000619389.1.71940 WP_000619389.1.71944 WP_000619389.1.71945 WP_000619389.1.71967 WP_000619389.1.71972 WP_000619389.1.71975 WP_000619389.1.71987 WP_000619389.1.71993 WP_000619389.1.71995 WP_000619389.1.72013 WP_000619389.1.72016 WP_000619389.1.72021 WP_000619389.1.72028 WP_000619389.1.72033 WP_000619389.1.72048 WP_000619389.1.7205 WP_000619389.1.72053 WP_000619389.1.72054 WP_000619389.1.72066 WP_000619389.1.72090 WP_000619389.1.72098 WP_000619389.1.7210 WP_000619389.1.72117 WP_000619389.1.72120 WP_000619389.1.72125 WP_000619389.1.72126 WP_000619389.1.72141 WP_000619389.1.72153 WP_000619389.1.72155 WP_000619389.1.72157 WP_000619389.1.72161 WP_000619389.1.72162 WP_000619389.1.72180 WP_000619389.1.72184 WP_000619389.1.72186 WP_000619389.1.72208 WP_000619389.1.72212 WP_000619389.1.72237 WP_000619389.1.72240 WP_000619389.1.72248 WP_000619389.1.7225 WP_000619389.1.72258 WP_000619389.1.72261 WP_000619389.1.72262 WP_000619389.1.72270 WP_000619389.1.72279 WP_000619389.1.72290 WP_000619389.1.72293 WP_000619389.1.72298 WP_000619389.1.723 WP_000619389.1.72316 WP_000619389.1.72322 WP_000619389.1.72337 WP_000619389.1.72342 WP_000619389.1.72352 WP_000619389.1.72359 WP_000619389.1.72362 WP_000619389.1.72388 WP_000619389.1.72391 WP_000619389.1.72392 WP_000619389.1.72397 WP_000619389.1.72414 WP_000619389.1.72425 WP_000619389.1.72427 WP_000619389.1.72431 WP_000619389.1.72436 WP_000619389.1.72449 WP_000619389.1.72469 WP_000619389.1.72485 WP_000619389.1.72493 WP_000619389.1.72507 WP_000619389.1.72511 WP_000619389.1.72521 WP_000619389.1.72522 WP_000619389.1.72535 WP_000619389.1.72537 WP_000619389.1.72551 WP_000619389.1.72574 WP_000619389.1.72582 WP_000619389.1.72588 WP_000619389.1.72593 WP_000619389.1.72596 WP_000619389.1.72599 WP_000619389.1.72606 WP_000619389.1.72608 WP_000619389.1.72614 WP_000619389.1.72615 WP_000619389.1.72616 WP_000619389.1.72619 WP_000619389.1.72641 WP_000619389.1.72643 WP_000619389.1.72651 WP_000619389.1.72652 WP_000619389.1.72663 WP_000619389.1.72694 WP_000619389.1.72695 WP_000619389.1.72698 WP_000619389.1.72700 WP_000619389.1.72706 WP_000619389.1.72725 WP_000619389.1.72729 WP_000619389.1.72738 WP_000619389.1.72745 WP_000619389.1.72747 WP_000619389.1.72748 WP_000619389.1.72751 WP_000619389.1.72758 WP_000619389.1.72764 WP_000619389.1.7277 WP_000619389.1.72778 WP_000619389.1.72804 WP_000619389.1.72806 WP_000619389.1.7281 WP_000619389.1.72837 WP_000619389.1.72857 WP_000619389.1.72858 WP_000619389.1.72860 WP_000619389.1.72869 WP_000619389.1.72893 WP_000619389.1.7291 WP_000619389.1.72910 WP_000619389.1.72913 WP_000619389.1.72947 WP_000619389.1.72950 WP_000619389.1.72956 WP_000619389.1.72962 WP_000619389.1.72998 WP_000619389.1.73000 WP_000619389.1.73010 WP_000619389.1.73015 WP_000619389.1.73032 WP_000619389.1.73039 WP_000619389.1.73061 WP_000619389.1.7307 WP_000619389.1.73072 WP_000619389.1.73075 WP_000619389.1.73085 WP_000619389.1.7309 WP_000619389.1.73094 WP_000619389.1.73126 WP_000619389.1.73129 WP_000619389.1.73193 WP_000619389.1.73197 WP_000619389.1.73215 WP_000619389.1.73217 WP_000619389.1.73230 WP_000619389.1.73239 WP_000619389.1.73243 WP_000619389.1.73249 WP_000619389.1.73251 WP_000619389.1.73257 WP_000619389.1.73259 WP_000619389.1.73277 WP_000619389.1.73278 WP_000619389.1.73283 WP_000619389.1.73291 WP_000619389.1.73292 WP_000619389.1.73295 WP_000619389.1.73326 WP_000619389.1.73333 WP_000619389.1.73340 WP_000619389.1.73343 WP_000619389.1.73344 WP_000619389.1.73349 WP_000619389.1.73385 WP_000619389.1.73393 WP_000619389.1.73428 WP_000619389.1.73430 WP_000619389.1.7345 WP_000619389.1.73468 WP_000619389.1.73486 WP_000619389.1.7349 WP_000619389.1.73498 WP_000619389.1.73524 WP_000619389.1.73565 WP_000619389.1.73572 WP_000619389.1.73592 WP_000619389.1.73604 WP_000619389.1.73626 WP_000619389.1.73631 WP_000619389.1.73652 WP_000619389.1.73663 WP_000619389.1.73700 WP_000619389.1.73709 WP_000619389.1.73717 WP_000619389.1.73748 WP_000619389.1.7376 WP_000619389.1.73783 WP_000619389.1.73785 WP_000619389.1.73797 WP_000619389.1.73801 WP_000619389.1.73807 WP_000619389.1.73811 WP_000619389.1.73827 WP_000619389.1.73835 WP_000619389.1.73843 WP_000619389.1.73844 WP_000619389.1.73846 WP_000619389.1.73859 WP_000619389.1.73882 WP_000619389.1.73897 WP_000619389.1.73908 WP_000619389.1.7392 WP_000619389.1.73934 WP_000619389.1.73942 WP_000619389.1.73968 WP_000619389.1.73980 WP_000619389.1.73992 WP_000619389.1.73995 WP_000619389.1.73996 WP_000619389.1.74032 WP_000619389.1.74041 WP_000619389.1.74045 WP_000619389.1.74046 WP_000619389.1.74051 WP_000619389.1.74053 WP_000619389.1.7407 WP_000619389.1.7411 WP_000619389.1.74123 WP_000619389.1.7413 WP_000619389.1.74156 WP_000619389.1.74184 WP_000619389.1.74185 WP_000619389.1.74213 WP_000619389.1.74223 WP_000619389.1.7424 WP_000619389.1.74243 WP_000619389.1.7425 WP_000619389.1.74251 WP_000619389.1.7429 WP_000619389.1.74294 WP_000619389.1.74309 WP_000619389.1.74358 WP_000619389.1.74365 WP_000619389.1.74367 WP_000619389.1.744 WP_000619389.1.74423 WP_000619389.1.74426 WP_000619389.1.74431 WP_000619389.1.74444 WP_000619389.1.74445 WP_000619389.1.7446 WP_000619389.1.74465 WP_000619389.1.74478 WP_000619389.1.74491 WP_000619389.1.74501 WP_000619389.1.74509 WP_000619389.1.74513 WP_000619389.1.74520 WP_000619389.1.74521 WP_000619389.1.74528 WP_000619389.1.74532 WP_000619389.1.74536 WP_000619389.1.74549 WP_000619389.1.74557 WP_000619389.1.74574 WP_000619389.1.7461 WP_000619389.1.74611 WP_000619389.1.74623 WP_000619389.1.74624 WP_000619389.1.74625 WP_000619389.1.74631 WP_000619389.1.74652 WP_000619389.1.74670 WP_000619389.1.74682 WP_000619389.1.74687 WP_000619389.1.74688 WP_000619389.1.74689 WP_000619389.1.74691 WP_000619389.1.74705 WP_000619389.1.7471 WP_000619389.1.74713 WP_000619389.1.74716 WP_000619389.1.74720 WP_000619389.1.74735 WP_000619389.1.7475 WP_000619389.1.74765 WP_000619389.1.74767 WP_000619389.1.7478 WP_000619389.1.7479 WP_000619389.1.74793 WP_000619389.1.74811 WP_000619389.1.74828 WP_000619389.1.74844 WP_000619389.1.74852 WP_000619389.1.74854 WP_000619389.1.74860 WP_000619389.1.74867 WP_000619389.1.74873 WP_000619389.1.74879 WP_000619389.1.74880 WP_000619389.1.74885 WP_000619389.1.74889 WP_000619389.1.74895 WP_000619389.1.74904 WP_000619389.1.74914 WP_000619389.1.74915 WP_000619389.1.74962 WP_000619389.1.74975 WP_000619389.1.74993 WP_000619389.1.74998 WP_000619389.1.75003 WP_000619389.1.75021 WP_000619389.1.75029 WP_000619389.1.75030 WP_000619389.1.75050 WP_000619389.1.75087 WP_000619389.1.75100 WP_000619389.1.75112 WP_000619389.1.75118 WP_000619389.1.75124 WP_000619389.1.75136 WP_000619389.1.75138 WP_000619389.1.75139 WP_000619389.1.75143 WP_000619389.1.75145 WP_000619389.1.75149 WP_000619389.1.75155 WP_000619389.1.7516 WP_000619389.1.75164 WP_000619389.1.75181 WP_000619389.1.75209 WP_000619389.1.75218 WP_000619389.1.75219 WP_000619389.1.75221 WP_000619389.1.75228 WP_000619389.1.75243 WP_000619389.1.75247 WP_000619389.1.75248 WP_000619389.1.75254 WP_000619389.1.75270 WP_000619389.1.75272 WP_000619389.1.75306 WP_000619389.1.7536 WP_000619389.1.75360 WP_000619389.1.75367 WP_000619389.1.75382 WP_000619389.1.7539 WP_000619389.1.75419 WP_000619389.1.75428 WP_000619389.1.75435 WP_000619389.1.75465 WP_000619389.1.75491 WP_000619389.1.75505 WP_000619389.1.75507 WP_000619389.1.75515 WP_000619389.1.75529 WP_000619389.1.75536 WP_000619389.1.75537 WP_000619389.1.75557 WP_000619389.1.75568 WP_000619389.1.75577 WP_000619389.1.75588 WP_000619389.1.75594 WP_000619389.1.75602 WP_000619389.1.75612 WP_000619389.1.75629 WP_000619389.1.75644 WP_000619389.1.75653 WP_000619389.1.75672 WP_000619389.1.75676 WP_000619389.1.75679 WP_000619389.1.75687 WP_000619389.1.75694 WP_000619389.1.75696 WP_000619389.1.75698 WP_000619389.1.75699 WP_000619389.1.75725 WP_000619389.1.75758 WP_000619389.1.75767 WP_000619389.1.75786 WP_000619389.1.75803 WP_000619389.1.75808 WP_000619389.1.7583 WP_000619389.1.75839 WP_000619389.1.75853 WP_000619389.1.75892 WP_000619389.1.75918 WP_000619389.1.75922 WP_000619389.1.7597 WP_000619389.1.75973 WP_000619389.1.75983 WP_000619389.1.75989 WP_000619389.1.75995 WP_000619389.1.75999 WP_000619389.1.76005 WP_000619389.1.76009 WP_000619389.1.76019 WP_000619389.1.7603 WP_000619389.1.76030 WP_000619389.1.76036 WP_000619389.1.76039 WP_000619389.1.76054 WP_000619389.1.76057 WP_000619389.1.7608 WP_000619389.1.76087 WP_000619389.1.76089 WP_000619389.1.76103 WP_000619389.1.76118 WP_000619389.1.76119 WP_000619389.1.76129 WP_000619389.1.7613 WP_000619389.1.76152 WP_000619389.1.7617 WP_000619389.1.76184 WP_000619389.1.76189 WP_000619389.1.76194 WP_000619389.1.76196 WP_000619389.1.76211 WP_000619389.1.76237 WP_000619389.1.76268 WP_000619389.1.76269 WP_000619389.1.76305 WP_000619389.1.76312 WP_000619389.1.76325 WP_000619389.1.76335 WP_000619389.1.76361 WP_000619389.1.7637 WP_000619389.1.76376 WP_000619389.1.76384 WP_000619389.1.76387 WP_000619389.1.76390 WP_000619389.1.76407 WP_000619389.1.76446 WP_000619389.1.76447 WP_000619389.1.76448 WP_000619389.1.76452 WP_000619389.1.76460 WP_000619389.1.76462 WP_000619389.1.76466 WP_000619389.1.76469 WP_000619389.1.76477 WP_000619389.1.76504 WP_000619389.1.76542 WP_000619389.1.76544 WP_000619389.1.76547 WP_000619389.1.76562 WP_000619389.1.76595 WP_000619389.1.76596 WP_000619389.1.7661 WP_000619389.1.76612 WP_000619389.1.76619 WP_000619389.1.76643 WP_000619389.1.76656 WP_000619389.1.76660 WP_000619389.1.76697 WP_000619389.1.76701 WP_000619389.1.76705 WP_000619389.1.76707 WP_000619389.1.76712 WP_000619389.1.76751 WP_000619389.1.76759 WP_000619389.1.7680 WP_000619389.1.76815 WP_000619389.1.76827 WP_000619389.1.76831 WP_000619389.1.76840 WP_000619389.1.76863 WP_000619389.1.76884 WP_000619389.1.7689 WP_000619389.1.76909 WP_000619389.1.76918 WP_000619389.1.76933 WP_000619389.1.76948 WP_000619389.1.76957 WP_000619389.1.76961 WP_000619389.1.76965 WP_000619389.1.76966 WP_000619389.1.7699 WP_000619389.1.76994 WP_000619389.1.77007 WP_000619389.1.77015 WP_000619389.1.77022 WP_000619389.1.77036 WP_000619389.1.77042 WP_000619389.1.77057 WP_000619389.1.77070 WP_000619389.1.77081 WP_000619389.1.77099 WP_000619389.1.771 WP_000619389.1.77109 WP_000619389.1.77120 WP_000619389.1.77128 WP_000619389.1.77134 WP_000619389.1.77147 WP_000619389.1.77162 WP_000619389.1.77163 WP_000619389.1.77173 WP_000619389.1.77175 WP_000619389.1.77198 WP_000619389.1.77200 WP_000619389.1.77204 WP_000619389.1.77214 WP_000619389.1.77224 WP_000619389.1.77239 WP_000619389.1.77253 WP_000619389.1.77255 WP_000619389.1.77258 WP_000619389.1.77275 WP_000619389.1.7728 WP_000619389.1.77284 WP_000619389.1.77288 WP_000619389.1.7729 WP_000619389.1.77290 WP_000619389.1.77291 WP_000619389.1.77296 WP_000619389.1.7731 WP_000619389.1.77320 WP_000619389.1.77326 WP_000619389.1.77341 WP_000619389.1.77358 WP_000619389.1.77391 WP_000619389.1.77392 WP_000619389.1.77408 WP_000619389.1.77419 WP_000619389.1.77432 WP_000619389.1.77437 WP_000619389.1.77448 WP_000619389.1.77452 WP_000619389.1.77455 WP_000619389.1.77462 WP_000619389.1.7747 WP_000619389.1.77470 WP_000619389.1.77471 WP_000619389.1.77477 WP_000619389.1.77481 WP_000619389.1.77487 WP_000619389.1.77495 WP_000619389.1.775 WP_000619389.1.7750 WP_000619389.1.77503 WP_000619389.1.77511 WP_000619389.1.77542 WP_000619389.1.77551 WP_000619389.1.7756 WP_000619389.1.77577 WP_000619389.1.77581 WP_000619389.1.77595 WP_000619389.1.77600 WP_000619389.1.77608 WP_000619389.1.77626 WP_000619389.1.77632 WP_000619389.1.77636 WP_000619389.1.77643 WP_000619389.1.77644 WP_000619389.1.77648 WP_000619389.1.77657 WP_000619389.1.77707 WP_000619389.1.77725 WP_000619389.1.77741 WP_000619389.1.7775 WP_000619389.1.77760 WP_000619389.1.77767 WP_000619389.1.77768 WP_000619389.1.7780 WP_000619389.1.7781 WP_000619389.1.77813 WP_000619389.1.77816 WP_000619389.1.77826 WP_000619389.1.77833 WP_000619389.1.77876 WP_000619389.1.77929 WP_000619389.1.77949 WP_000619389.1.7795 WP_000619389.1.77950 WP_000619389.1.77961 WP_000619389.1.77979 WP_000619389.1.7799 WP_000619389.1.77999 WP_000619389.1.78000 WP_000619389.1.78007 WP_000619389.1.78010 WP_000619389.1.7804 WP_000619389.1.78041 WP_000619389.1.78059 WP_000619389.1.7806 WP_000619389.1.78063 WP_000619389.1.7808 WP_000619389.1.78089 WP_000619389.1.78097 WP_000619389.1.78099 WP_000619389.1.78101 WP_000619389.1.78131 WP_000619389.1.78183 WP_000619389.1.78187 WP_000619389.1.78188 WP_000619389.1.78196 WP_000619389.1.78202 WP_000619389.1.78232 WP_000619389.1.78233 WP_000619389.1.78235 WP_000619389.1.78297 WP_000619389.1.78305 WP_000619389.1.78321 WP_000619389.1.78323 WP_000619389.1.78337 WP_000619389.1.78340 WP_000619389.1.78368 WP_000619389.1.78376 WP_000619389.1.78377 WP_000619389.1.78390 WP_000619389.1.784 WP_000619389.1.78413 WP_000619389.1.78445 WP_000619389.1.78453 WP_000619389.1.78462 WP_000619389.1.78463 WP_000619389.1.7847 WP_000619389.1.78477 WP_000619389.1.78481 WP_000619389.1.78491 WP_000619389.1.7851 WP_000619389.1.78512 WP_000619389.1.78515 WP_000619389.1.78523 WP_000619389.1.78527 WP_000619389.1.7855 WP_000619389.1.78553 WP_000619389.1.78572 WP_000619389.1.78575 WP_000619389.1.78581 WP_000619389.1.78583 WP_000619389.1.78586 WP_000619389.1.78593 WP_000619389.1.78610 WP_000619389.1.78611 WP_000619389.1.78612 WP_000619389.1.78615 WP_000619389.1.78622 WP_000619389.1.78645 WP_000619389.1.78677 WP_000619389.1.78683 WP_000619389.1.78687 WP_000619389.1.78689 WP_000619389.1.78696 WP_000619389.1.78698 WP_000619389.1.78706 WP_000619389.1.78714 WP_000619389.1.78718 WP_000619389.1.78746 WP_000619389.1.78750 WP_000619389.1.78757 WP_000619389.1.78773 WP_000619389.1.78775 WP_000619389.1.78791 WP_000619389.1.78814 WP_000619389.1.7883 WP_000619389.1.78843 WP_000619389.1.78845 WP_000619389.1.78854 WP_000619389.1.78888 WP_000619389.1.78891 WP_000619389.1.78893 WP_000619389.1.78895 WP_000619389.1.78908 WP_000619389.1.78919 WP_000619389.1.78953 WP_000619389.1.78956 WP_000619389.1.7896 WP_000619389.1.78966 WP_000619389.1.7898 WP_000619389.1.78996 WP_000619389.1.79001 WP_000619389.1.79002 WP_000619389.1.79004 WP_000619389.1.7901 WP_000619389.1.79065 WP_000619389.1.79067 WP_000619389.1.79075 WP_000619389.1.79086 WP_000619389.1.79088 WP_000619389.1.79090 WP_000619389.1.79092 WP_000619389.1.79100 WP_000619389.1.79126 WP_000619389.1.79137 WP_000619389.1.79159 WP_000619389.1.79172 WP_000619389.1.79226 WP_000619389.1.79233 WP_000619389.1.79243 WP_000619389.1.79246 WP_000619389.1.79248 WP_000619389.1.79249 WP_000619389.1.79276 WP_000619389.1.79306 WP_000619389.1.79308 WP_000619389.1.79312 WP_000619389.1.79342 WP_000619389.1.79343 WP_000619389.1.79346 WP_000619389.1.79348 WP_000619389.1.79356 WP_000619389.1.79365 WP_000619389.1.79368 WP_000619389.1.79369 WP_000619389.1.7937 WP_000619389.1.79389 WP_000619389.1.79391 WP_000619389.1.7940 WP_000619389.1.79409 WP_000619389.1.79414 WP_000619389.1.79416 WP_000619389.1.79443 WP_000619389.1.79464 WP_000619389.1.79478 WP_000619389.1.79505 WP_000619389.1.79519 WP_000619389.1.7952 WP_000619389.1.79525 WP_000619389.1.79526 WP_000619389.1.79528 WP_000619389.1.79540 WP_000619389.1.79558 WP_000619389.1.79563 WP_000619389.1.79576 WP_000619389.1.79591 WP_000619389.1.79606 WP_000619389.1.79619 WP_000619389.1.79640 WP_000619389.1.7967 WP_000619389.1.79685 WP_000619389.1.79707 WP_000619389.1.79713 WP_000619389.1.79715 WP_000619389.1.79749 WP_000619389.1.79759 WP_000619389.1.79764 WP_000619389.1.79800 WP_000619389.1.79816 WP_000619389.1.79824 WP_000619389.1.79840 WP_000619389.1.79866 WP_000619389.1.79869 WP_000619389.1.7987 WP_000619389.1.79871 WP_000619389.1.79877 WP_000619389.1.79905 WP_000619389.1.79922 WP_000619389.1.7993 WP_000619389.1.79930 WP_000619389.1.79931 WP_000619389.1.79932 WP_000619389.1.79933 WP_000619389.1.79936 WP_000619389.1.79944 WP_000619389.1.79952 WP_000619389.1.79955 WP_000619389.1.79965 WP_000619389.1.79973 WP_000619389.1.79984 WP_000619389.1.79995 WP_000619389.1.80 WP_000619389.1.80011 WP_000619389.1.80016 WP_000619389.1.80026 WP_000619389.1.8004 WP_000619389.1.80043 WP_000619389.1.80050 WP_000619389.1.80060 WP_000619389.1.80061 WP_000619389.1.80063 WP_000619389.1.8007 WP_000619389.1.80071 WP_000619389.1.80096 WP_000619389.1.80106 WP_000619389.1.8011 WP_000619389.1.80112 WP_000619389.1.80136 WP_000619389.1.80141 WP_000619389.1.80168 WP_000619389.1.80176 WP_000619389.1.80179 WP_000619389.1.80183 WP_000619389.1.80192 WP_000619389.1.80255 WP_000619389.1.80292 WP_000619389.1.80309 WP_000619389.1.80310 WP_000619389.1.80320 WP_000619389.1.80330 WP_000619389.1.80343 WP_000619389.1.80388 WP_000619389.1.80392 WP_000619389.1.804 WP_000619389.1.80402 WP_000619389.1.80426 WP_000619389.1.80428 WP_000619389.1.80440 WP_000619389.1.80444 WP_000619389.1.80456 WP_000619389.1.80463 WP_000619389.1.80484 WP_000619389.1.80517 WP_000619389.1.80519 WP_000619389.1.80524 WP_000619389.1.80545 WP_000619389.1.80558 WP_000619389.1.80559 WP_000619389.1.8057 WP_000619389.1.80577 WP_000619389.1.80578 WP_000619389.1.80594 WP_000619389.1.80606 WP_000619389.1.80612 WP_000619389.1.80626 WP_000619389.1.80660 WP_000619389.1.80662 WP_000619389.1.80666 WP_000619389.1.80676 WP_000619389.1.8068 WP_000619389.1.80709 WP_000619389.1.80718 WP_000619389.1.80724 WP_000619389.1.80731 WP_000619389.1.80736 WP_000619389.1.80737 WP_000619389.1.8074 WP_000619389.1.80753 WP_000619389.1.80754 WP_000619389.1.80756 WP_000619389.1.8076 WP_000619389.1.80768 WP_000619389.1.80789 WP_000619389.1.808 WP_000619389.1.80804 WP_000619389.1.80805 WP_000619389.1.80843 WP_000619389.1.80862 WP_000619389.1.80882 WP_000619389.1.80884 WP_000619389.1.80894 WP_000619389.1.8090 WP_000619389.1.8091 WP_000619389.1.80935 WP_000619389.1.80945 WP_000619389.1.80946 WP_000619389.1.80948 WP_000619389.1.80954 WP_000619389.1.80966 WP_000619389.1.80983 WP_000619389.1.80985 WP_000619389.1.810 WP_000619389.1.81026 WP_000619389.1.81032 WP_000619389.1.81034 WP_000619389.1.81036 WP_000619389.1.81054 WP_000619389.1.81056 WP_000619389.1.81070 WP_000619389.1.81071 WP_000619389.1.81098 WP_000619389.1.811 WP_000619389.1.81104 WP_000619389.1.81120 WP_000619389.1.81127 WP_000619389.1.81141 WP_000619389.1.81156 WP_000619389.1.81165 WP_000619389.1.8118 WP_000619389.1.81180 WP_000619389.1.81182 WP_000619389.1.81186 WP_000619389.1.8121 WP_000619389.1.81219 WP_000619389.1.81266 WP_000619389.1.81267 WP_000619389.1.81273 WP_000619389.1.81281 WP_000619389.1.81286 WP_000619389.1.8129 WP_000619389.1.81298 WP_000619389.1.81313 WP_000619389.1.81316 WP_000619389.1.81323 WP_000619389.1.81347 WP_000619389.1.81376 WP_000619389.1.81391 WP_000619389.1.81396 WP_000619389.1.814 WP_000619389.1.81418 WP_000619389.1.81420 WP_000619389.1.81423 WP_000619389.1.81438 WP_000619389.1.81442 WP_000619389.1.81469 WP_000619389.1.81475 WP_000619389.1.81484 WP_000619389.1.81514 WP_000619389.1.81517 WP_000619389.1.8156 WP_000619389.1.81576 WP_000619389.1.81577 WP_000619389.1.81580 WP_000619389.1.81582 WP_000619389.1.81588 WP_000619389.1.81589 WP_000619389.1.81596 WP_000619389.1.81602 WP_000619389.1.81618 WP_000619389.1.81624 WP_000619389.1.81625 WP_000619389.1.81688 WP_000619389.1.81692 WP_000619389.1.81715 WP_000619389.1.8172 WP_000619389.1.81723 WP_000619389.1.81739 WP_000619389.1.81754 WP_000619389.1.81761 WP_000619389.1.81806 WP_000619389.1.81819 WP_000619389.1.81821 WP_000619389.1.8183 WP_000619389.1.81832 WP_000619389.1.81843 WP_000619389.1.81869 WP_000619389.1.81873 WP_000619389.1.81876 WP_000619389.1.81881 WP_000619389.1.81888 WP_000619389.1.81914 WP_000619389.1.81934 WP_000619389.1.81939 WP_000619389.1.81952 WP_000619389.1.81956 WP_000619389.1.81972 WP_000619389.1.81975 WP_000619389.1.82 WP_000619389.1.82008 WP_000619389.1.82010 WP_000619389.1.82032 WP_000619389.1.82057 WP_000619389.1.82059 WP_000619389.1.82061 WP_000619389.1.82062 WP_000619389.1.82074 WP_000619389.1.82095 WP_000619389.1.82104 WP_000619389.1.82106 WP_000619389.1.82116 WP_000619389.1.82123 WP_000619389.1.82137 WP_000619389.1.82166 WP_000619389.1.82217 WP_000619389.1.82221 WP_000619389.1.82239 WP_000619389.1.82240 WP_000619389.1.82242 WP_000619389.1.82246 WP_000619389.1.82275 WP_000619389.1.82280 WP_000619389.1.82296 WP_000619389.1.82316 WP_000619389.1.82320 WP_000619389.1.82326 WP_000619389.1.82330 WP_000619389.1.8235 WP_000619389.1.82378 WP_000619389.1.82438 WP_000619389.1.82439 WP_000619389.1.82485 WP_000619389.1.82499 WP_000619389.1.82507 WP_000619389.1.82514 WP_000619389.1.82527 WP_000619389.1.82536 WP_000619389.1.82539 WP_000619389.1.8255 WP_000619389.1.82572 WP_000619389.1.82589 WP_000619389.1.82594 WP_000619389.1.82614 WP_000619389.1.82626 WP_000619389.1.82629 WP_000619389.1.82647 WP_000619389.1.82661 WP_000619389.1.8268 WP_000619389.1.82682 WP_000619389.1.82691 WP_000619389.1.82698 WP_000619389.1.82700 WP_000619389.1.82705 WP_000619389.1.82711 WP_000619389.1.82715 WP_000619389.1.82718 WP_000619389.1.82747 WP_000619389.1.82754 WP_000619389.1.8277 WP_000619389.1.82776 WP_000619389.1.82780 WP_000619389.1.82797 WP_000619389.1.82799 WP_000619389.1.82808 WP_000619389.1.82816 WP_000619389.1.82820 WP_000619389.1.82831 WP_000619389.1.82833 WP_000619389.1.82853 WP_000619389.1.82901 WP_000619389.1.82902 WP_000619389.1.82923 WP_000619389.1.8295 WP_000619389.1.82991 WP_000619389.1.83020 WP_000619389.1.83033 WP_000619389.1.83035 WP_000619389.1.83036 WP_000619389.1.83051 WP_000619389.1.83059 WP_000619389.1.8306 WP_000619389.1.8308 WP_000619389.1.83093 WP_000619389.1.83097 WP_000619389.1.83099 WP_000619389.1.831 WP_000619389.1.83118 WP_000619389.1.83125 WP_000619389.1.83127 WP_000619389.1.83140 WP_000619389.1.83144 WP_000619389.1.83151 WP_000619389.1.83160 WP_000619389.1.83177 WP_000619389.1.83205 WP_000619389.1.83214 WP_000619389.1.83218 WP_000619389.1.83224 WP_000619389.1.83238 WP_000619389.1.83253 WP_000619389.1.83286 WP_000619389.1.83313 WP_000619389.1.83321 WP_000619389.1.83330 WP_000619389.1.83340 WP_000619389.1.83347 WP_000619389.1.83375 WP_000619389.1.83384 WP_000619389.1.83393 WP_000619389.1.8345 WP_000619389.1.83466 WP_000619389.1.83481 WP_000619389.1.83506 WP_000619389.1.83537 WP_000619389.1.83544 WP_000619389.1.83564 WP_000619389.1.83582 WP_000619389.1.83584 WP_000619389.1.83644 WP_000619389.1.83660 WP_000619389.1.83668 WP_000619389.1.8368 WP_000619389.1.83684 WP_000619389.1.83706 WP_000619389.1.83712 WP_000619389.1.83735 WP_000619389.1.83762 WP_000619389.1.83781 WP_000619389.1.83807 WP_000619389.1.83820 WP_000619389.1.8384 WP_000619389.1.8386 WP_000619389.1.83879 WP_000619389.1.83911 WP_000619389.1.83936 WP_000619389.1.83941 WP_000619389.1.83947 WP_000619389.1.84004 WP_000619389.1.84014 WP_000619389.1.84021 WP_000619389.1.8405 WP_000619389.1.84059 WP_000619389.1.84060 WP_000619389.1.84074 WP_000619389.1.8408 WP_000619389.1.8411 WP_000619389.1.84140 WP_000619389.1.84164 WP_000619389.1.84172 WP_000619389.1.84185 WP_000619389.1.84197 WP_000619389.1.84210 WP_000619389.1.84215 WP_000619389.1.84219 WP_000619389.1.84221 WP_000619389.1.84264 WP_000619389.1.84312 WP_000619389.1.84313 WP_000619389.1.84316 WP_000619389.1.84319 WP_000619389.1.84326 WP_000619389.1.84331 WP_000619389.1.84339 WP_000619389.1.84348 WP_000619389.1.84402 WP_000619389.1.84405 WP_000619389.1.84410 WP_000619389.1.84436 WP_000619389.1.8444 WP_000619389.1.84462 WP_000619389.1.84464 WP_000619389.1.84467 WP_000619389.1.8447 WP_000619389.1.84473 WP_000619389.1.84476 WP_000619389.1.84482 WP_000619389.1.84484 WP_000619389.1.84486 WP_000619389.1.84511 WP_000619389.1.84518 WP_000619389.1.84531 WP_000619389.1.84534 WP_000619389.1.84584 WP_000619389.1.84635 WP_000619389.1.84639 WP_000619389.1.84656 WP_000619389.1.84657 WP_000619389.1.84668 WP_000619389.1.84675 WP_000619389.1.84697 WP_000619389.1.8470 WP_000619389.1.84731 WP_000619389.1.84738 WP_000619389.1.84740 WP_000619389.1.84768 WP_000619389.1.8477 WP_000619389.1.84797 WP_000619389.1.84841 WP_000619389.1.84850 WP_000619389.1.84875 WP_000619389.1.84877 WP_000619389.1.84878 WP_000619389.1.84881 WP_000619389.1.84893 WP_000619389.1.84894 WP_000619389.1.84916 WP_000619389.1.84929 WP_000619389.1.84941 WP_000619389.1.84948 WP_000619389.1.84972 WP_000619389.1.84977 WP_000619389.1.84986 WP_000619389.1.84989 WP_000619389.1.84990 WP_000619389.1.84994 WP_000619389.1.85002 WP_000619389.1.85008 WP_000619389.1.85011 WP_000619389.1.85025 WP_000619389.1.85048 WP_000619389.1.85052 WP_000619389.1.85077 WP_000619389.1.85085 WP_000619389.1.85090 WP_000619389.1.85098 WP_000619389.1.85105 WP_000619389.1.85106 WP_000619389.1.85112 WP_000619389.1.85125 WP_000619389.1.85129 WP_000619389.1.85138 WP_000619389.1.85141 WP_000619389.1.85155 WP_000619389.1.85156 WP_000619389.1.8517 WP_000619389.1.85175 WP_000619389.1.85188 WP_000619389.1.85216 WP_000619389.1.85241 WP_000619389.1.85247 WP_000619389.1.85252 WP_000619389.1.85253 WP_000619389.1.85255 WP_000619389.1.85260 WP_000619389.1.8530 WP_000619389.1.85305 WP_000619389.1.85310 WP_000619389.1.85315 WP_000619389.1.85320 WP_000619389.1.85323 WP_000619389.1.85329 WP_000619389.1.85335 WP_000619389.1.85336 WP_000619389.1.85342 WP_000619389.1.85361 WP_000619389.1.85369 WP_000619389.1.85384 WP_000619389.1.85385 WP_000619389.1.85416 WP_000619389.1.85435 WP_000619389.1.85500 WP_000619389.1.85504 WP_000619389.1.85525 WP_000619389.1.85546 WP_000619389.1.85554 WP_000619389.1.85556 WP_000619389.1.85558 WP_000619389.1.85563 WP_000619389.1.85578 WP_000619389.1.85593 WP_000619389.1.8560 WP_000619389.1.85601 WP_000619389.1.85621 WP_000619389.1.85623 WP_000619389.1.8564 WP_000619389.1.85657 WP_000619389.1.85685 WP_000619389.1.85722 WP_000619389.1.85752 WP_000619389.1.85762 WP_000619389.1.85767 WP_000619389.1.85772 WP_000619389.1.85773 WP_000619389.1.85781 WP_000619389.1.8579 WP_000619389.1.85793 WP_000619389.1.85800 WP_000619389.1.85806 WP_000619389.1.8582 WP_000619389.1.85857 WP_000619389.1.85895 WP_000619389.1.8592 WP_000619389.1.85939 WP_000619389.1.85944 WP_000619389.1.85948 WP_000619389.1.85969 WP_000619389.1.86 WP_000619389.1.86001 WP_000619389.1.86016 WP_000619389.1.8603 WP_000619389.1.86035 WP_000619389.1.86063 WP_000619389.1.8607 WP_000619389.1.86104 WP_000619389.1.86105 WP_000619389.1.86110 WP_000619389.1.86115 WP_000619389.1.86145 WP_000619389.1.86149 WP_000619389.1.86161 WP_000619389.1.86166 WP_000619389.1.86171 WP_000619389.1.86176 WP_000619389.1.86179 WP_000619389.1.86181 WP_000619389.1.86189 WP_000619389.1.86196 WP_000619389.1.8621 WP_000619389.1.86210 WP_000619389.1.86225 WP_000619389.1.86227 WP_000619389.1.86228 WP_000619389.1.86234 WP_000619389.1.86255 WP_000619389.1.86261 WP_000619389.1.86263 WP_000619389.1.86266 WP_000619389.1.86273 WP_000619389.1.86276 WP_000619389.1.86280 WP_000619389.1.86283 WP_000619389.1.86294 WP_000619389.1.86307 WP_000619389.1.86340 WP_000619389.1.8635 WP_000619389.1.86353 WP_000619389.1.86355 WP_000619389.1.86364 WP_000619389.1.86371 WP_000619389.1.86376 WP_000619389.1.86393 WP_000619389.1.86411 WP_000619389.1.86412 WP_000619389.1.86437 WP_000619389.1.86451 WP_000619389.1.86452 WP_000619389.1.86454 WP_000619389.1.86461 WP_000619389.1.86475 WP_000619389.1.86483 WP_000619389.1.86492 WP_000619389.1.86518 WP_000619389.1.8652 WP_000619389.1.8656 WP_000619389.1.86560 WP_000619389.1.86574 WP_000619389.1.86583 WP_000619389.1.86586 WP_000619389.1.86598 WP_000619389.1.86609 WP_000619389.1.86613 WP_000619389.1.86617 WP_000619389.1.86627 WP_000619389.1.86640 WP_000619389.1.86667 WP_000619389.1.86673 WP_000619389.1.86674 WP_000619389.1.86681 WP_000619389.1.86691 WP_000619389.1.86707 WP_000619389.1.86717 WP_000619389.1.86727 WP_000619389.1.86731 WP_000619389.1.86734 WP_000619389.1.86753 WP_000619389.1.86760 WP_000619389.1.86768 WP_000619389.1.86787 WP_000619389.1.86788 WP_000619389.1.8679 WP_000619389.1.86833 WP_000619389.1.86846 WP_000619389.1.8687 WP_000619389.1.86934 WP_000619389.1.86935 WP_000619389.1.86956 WP_000619389.1.86959 WP_000619389.1.86975 WP_000619389.1.86994 WP_000619389.1.86997 WP_000619389.1.87043 WP_000619389.1.8705 WP_000619389.1.87059 WP_000619389.1.87067 WP_000619389.1.87074 WP_000619389.1.87075 WP_000619389.1.87076 WP_000619389.1.87102 WP_000619389.1.87109 WP_000619389.1.8711 WP_000619389.1.87147 WP_000619389.1.87177 WP_000619389.1.87189 WP_000619389.1.87199 WP_000619389.1.87205 WP_000619389.1.87247 WP_000619389.1.87249 WP_000619389.1.87254 WP_000619389.1.87310 WP_000619389.1.87339 WP_000619389.1.87358 WP_000619389.1.87371 WP_000619389.1.87382 WP_000619389.1.87389 WP_000619389.1.87400 WP_000619389.1.87410 WP_000619389.1.87443 WP_000619389.1.87465 WP_000619389.1.87491 WP_000619389.1.87504 WP_000619389.1.87557 WP_000619389.1.87563 WP_000619389.1.87568 WP_000619389.1.87574 WP_000619389.1.87581 WP_000619389.1.87590 WP_000619389.1.87607 WP_000619389.1.87608 WP_000619389.1.87610 WP_000619389.1.87616 WP_000619389.1.87633 WP_000619389.1.87635 WP_000619389.1.87639 WP_000619389.1.87655 WP_000619389.1.87675 WP_000619389.1.87694 WP_000619389.1.87696 WP_000619389.1.8771 WP_000619389.1.87721 WP_000619389.1.87726 WP_000619389.1.87728 WP_000619389.1.87733 WP_000619389.1.87738 WP_000619389.1.87766 WP_000619389.1.8778 WP_000619389.1.87786 WP_000619389.1.87788 WP_000619389.1.87789 WP_000619389.1.87822 WP_000619389.1.87834 WP_000619389.1.87857 WP_000619389.1.87883 WP_000619389.1.87914 WP_000619389.1.87919 WP_000619389.1.87973 WP_000619389.1.87976 WP_000619389.1.87980 WP_000619389.1.87984 WP_000619389.1.87989 WP_000619389.1.87990 WP_000619389.1.880 WP_000619389.1.88017 WP_000619389.1.88020 WP_000619389.1.88066 WP_000619389.1.8807 WP_000619389.1.88082 WP_000619389.1.88088 WP_000619389.1.88110 WP_000619389.1.88119 WP_000619389.1.88147 WP_000619389.1.88149 WP_000619389.1.88155 WP_000619389.1.88189 WP_000619389.1.88197 WP_000619389.1.8822 WP_000619389.1.88234 WP_000619389.1.88238 WP_000619389.1.88252 WP_000619389.1.88260 WP_000619389.1.88263 WP_000619389.1.88285 WP_000619389.1.88301 WP_000619389.1.88304 WP_000619389.1.88336 WP_000619389.1.88352 WP_000619389.1.88376 WP_000619389.1.88379 WP_000619389.1.88384 WP_000619389.1.88413 WP_000619389.1.88427 WP_000619389.1.8843 WP_000619389.1.88434 WP_000619389.1.88438 WP_000619389.1.88462 WP_000619389.1.88467 WP_000619389.1.8848 WP_000619389.1.88499 WP_000619389.1.88505 WP_000619389.1.88524 WP_000619389.1.88527 WP_000619389.1.88528 WP_000619389.1.88535 WP_000619389.1.88539 WP_000619389.1.8854 WP_000619389.1.8855 WP_000619389.1.88557 WP_000619389.1.88562 WP_000619389.1.88577 WP_000619389.1.88598 WP_000619389.1.88603 WP_000619389.1.88607 WP_000619389.1.88631 WP_000619389.1.88646 WP_000619389.1.88667 WP_000619389.1.88678 WP_000619389.1.88685 WP_000619389.1.88686 WP_000619389.1.88709 WP_000619389.1.88710 WP_000619389.1.88711 WP_000619389.1.88717 WP_000619389.1.88720 WP_000619389.1.88729 WP_000619389.1.8873 WP_000619389.1.88732 WP_000619389.1.88735 WP_000619389.1.88752 WP_000619389.1.88757 WP_000619389.1.88759 WP_000619389.1.88767 WP_000619389.1.8879 WP_000619389.1.88793 WP_000619389.1.88803 WP_000619389.1.88826 WP_000619389.1.88834 WP_000619389.1.88864 WP_000619389.1.88880 WP_000619389.1.88883 WP_000619389.1.88891 WP_000619389.1.88941 WP_000619389.1.88950 WP_000619389.1.88953 WP_000619389.1.88961 WP_000619389.1.88997 WP_000619389.1.89018 WP_000619389.1.89043 WP_000619389.1.89050 WP_000619389.1.8906 WP_000619389.1.89067 WP_000619389.1.89069 WP_000619389.1.89090 WP_000619389.1.89097 WP_000619389.1.89099 WP_000619389.1.89111 WP_000619389.1.89150 WP_000619389.1.89163 WP_000619389.1.89165 WP_000619389.1.89183 WP_000619389.1.89197 WP_000619389.1.89200 WP_000619389.1.89203 WP_000619389.1.89214 WP_000619389.1.89217 WP_000619389.1.89255 WP_000619389.1.8928 WP_000619389.1.89285 WP_000619389.1.89305 WP_000619389.1.89312 WP_000619389.1.89322 WP_000619389.1.89334 WP_000619389.1.89335 WP_000619389.1.89351 WP_000619389.1.89379 WP_000619389.1.8938 WP_000619389.1.89385 WP_000619389.1.89396 WP_000619389.1.894 WP_000619389.1.89400 WP_000619389.1.89403 WP_000619389.1.89405 WP_000619389.1.89416 WP_000619389.1.89427 WP_000619389.1.89432 WP_000619389.1.8945 WP_000619389.1.89455 WP_000619389.1.89458 WP_000619389.1.89466 WP_000619389.1.89468 WP_000619389.1.89469 WP_000619389.1.89471 WP_000619389.1.89474 WP_000619389.1.89479 WP_000619389.1.89492 WP_000619389.1.89496 WP_000619389.1.89510 WP_000619389.1.89551 WP_000619389.1.89569 WP_000619389.1.89583 WP_000619389.1.89601 WP_000619389.1.89605 WP_000619389.1.89627 WP_000619389.1.89630 WP_000619389.1.89631 WP_000619389.1.89646 WP_000619389.1.89656 WP_000619389.1.89674 WP_000619389.1.89679 WP_000619389.1.89700 WP_000619389.1.89745 WP_000619389.1.89747 WP_000619389.1.89768 WP_000619389.1.89781 WP_000619389.1.89788 WP_000619389.1.89818 WP_000619389.1.89839 WP_000619389.1.89841 WP_000619389.1.8985 WP_000619389.1.89852 WP_000619389.1.89859 WP_000619389.1.89879 WP_000619389.1.89895 WP_000619389.1.89899 WP_000619389.1.89915 WP_000619389.1.89917 WP_000619389.1.89918 WP_000619389.1.89920 WP_000619389.1.89923 WP_000619389.1.89925 WP_000619389.1.89959 WP_000619389.1.89977 WP_000619389.1.89988 WP_000619389.1.89998 WP_000619389.1.90017 WP_000619389.1.90022 WP_000619389.1.90050 WP_000619389.1.90063 WP_000619389.1.90065 WP_000619389.1.90078 WP_000619389.1.9009 WP_000619389.1.9010 WP_000619389.1.90115 WP_000619389.1.90128 WP_000619389.1.90139 WP_000619389.1.90146 WP_000619389.1.90156 WP_000619389.1.90168 WP_000619389.1.90171 WP_000619389.1.90182 WP_000619389.1.902 WP_000619389.1.90205 WP_000619389.1.90219 WP_000619389.1.90249 WP_000619389.1.90256 WP_000619389.1.90257 WP_000619389.1.90266 WP_000619389.1.90270 WP_000619389.1.90314 WP_000619389.1.90315 WP_000619389.1.90332 WP_000619389.1.90342 WP_000619389.1.90346 WP_000619389.1.90349 WP_000619389.1.90357 WP_000619389.1.90358 WP_000619389.1.9036 WP_000619389.1.9037 WP_000619389.1.90389 WP_000619389.1.90405 WP_000619389.1.90435 WP_000619389.1.90436 WP_000619389.1.90441 WP_000619389.1.90449 WP_000619389.1.90467 WP_000619389.1.90511 WP_000619389.1.90520 WP_000619389.1.90525 WP_000619389.1.90536 WP_000619389.1.90547 WP_000619389.1.9059 WP_000619389.1.90591 WP_000619389.1.90602 WP_000619389.1.9061 WP_000619389.1.90626 WP_000619389.1.90690 WP_000619389.1.90703 WP_000619389.1.90706 WP_000619389.1.90758 WP_000619389.1.90799 WP_000619389.1.9081 WP_000619389.1.90813 WP_000619389.1.90822 WP_000619389.1.90828 WP_000619389.1.90834 WP_000619389.1.90837 WP_000619389.1.90839 WP_000619389.1.9084 WP_000619389.1.90842 WP_000619389.1.90844 WP_000619389.1.90848 WP_000619389.1.90856 WP_000619389.1.90864 WP_000619389.1.90865 WP_000619389.1.9087 WP_000619389.1.90873 WP_000619389.1.90890 WP_000619389.1.909 WP_000619389.1.90905 WP_000619389.1.90924 WP_000619389.1.90951 WP_000619389.1.90960 WP_000619389.1.90967 WP_000619389.1.90979 WP_000619389.1.9098 WP_000619389.1.90988 WP_000619389.1.90996 WP_000619389.1.90997 WP_000619389.1.91 WP_000619389.1.91007 WP_000619389.1.91010 WP_000619389.1.91018 WP_000619389.1.9104 WP_000619389.1.91072 WP_000619389.1.91088 WP_000619389.1.91094 WP_000619389.1.91113 WP_000619389.1.91117 WP_000619389.1.91121 WP_000619389.1.91138 WP_000619389.1.91143 WP_000619389.1.91153 WP_000619389.1.91170 WP_000619389.1.9118 WP_000619389.1.91182 WP_000619389.1.9119 WP_000619389.1.91213 WP_000619389.1.91220 WP_000619389.1.91266 WP_000619389.1.91268 WP_000619389.1.91277 WP_000619389.1.91288 WP_000619389.1.91290 WP_000619389.1.91340 WP_000619389.1.91341 WP_000619389.1.91354 WP_000619389.1.91356 WP_000619389.1.91361 WP_000619389.1.91377 WP_000619389.1.91384 WP_000619389.1.91397 WP_000619389.1.91414 WP_000619389.1.91425 WP_000619389.1.91445 WP_000619389.1.91462 WP_000619389.1.91482 WP_000619389.1.91485 WP_000619389.1.91494 WP_000619389.1.915 WP_000619389.1.91511 WP_000619389.1.91515 WP_000619389.1.91516 WP_000619389.1.91526 WP_000619389.1.91543 WP_000619389.1.91548 WP_000619389.1.91549 WP_000619389.1.91551 WP_000619389.1.91565 WP_000619389.1.91566 WP_000619389.1.9157 WP_000619389.1.91594 WP_000619389.1.91596 WP_000619389.1.9160 WP_000619389.1.91626 WP_000619389.1.91630 WP_000619389.1.91643 WP_000619389.1.91644 WP_000619389.1.91651 WP_000619389.1.91666 WP_000619389.1.91672 WP_000619389.1.9168 WP_000619389.1.91685 WP_000619389.1.9169 WP_000619389.1.91701 WP_000619389.1.9171 WP_000619389.1.91739 WP_000619389.1.91756 WP_000619389.1.91777 WP_000619389.1.91779 WP_000619389.1.91782 WP_000619389.1.91787 WP_000619389.1.91793 WP_000619389.1.91801 WP_000619389.1.91814 WP_000619389.1.91843 WP_000619389.1.9185 WP_000619389.1.91850 WP_000619389.1.91863 WP_000619389.1.91871 WP_000619389.1.91879 WP_000619389.1.91887 WP_000619389.1.91894 WP_000619389.1.91951 WP_000619389.1.91954 WP_000619389.1.91959 WP_000619389.1.91965 WP_000619389.1.91971 WP_000619389.1.9199 WP_000619389.1.91994 WP_000619389.1.92005 WP_000619389.1.92014 WP_000619389.1.92019 WP_000619389.1.92025 WP_000619389.1.92029 WP_000619389.1.92031 WP_000619389.1.92048 WP_000619389.1.92053 WP_000619389.1.92058 WP_000619389.1.9209 WP_000619389.1.92096 WP_000619389.1.921 WP_000619389.1.92102 WP_000619389.1.92114 WP_000619389.1.92123 WP_000619389.1.9215 WP_000619389.1.92161 WP_000619389.1.92163 WP_000619389.1.92180 WP_000619389.1.92195 WP_000619389.1.92201 WP_000619389.1.92215 WP_000619389.1.92224 WP_000619389.1.92276 WP_000619389.1.92295 WP_000619389.1.92304 WP_000619389.1.92305 WP_000619389.1.92311 WP_000619389.1.92323 WP_000619389.1.92361 WP_000619389.1.92384 WP_000619389.1.924 WP_000619389.1.92403 WP_000619389.1.92434 WP_000619389.1.92462 WP_000619389.1.92473 WP_000619389.1.92495 WP_000619389.1.92496 WP_000619389.1.92506 WP_000619389.1.92532 WP_000619389.1.92535 WP_000619389.1.9255 WP_000619389.1.92568 WP_000619389.1.92571 WP_000619389.1.92577 WP_000619389.1.92614 WP_000619389.1.92615 WP_000619389.1.92634 WP_000619389.1.92638 WP_000619389.1.9264 WP_000619389.1.92648 WP_000619389.1.9266 WP_000619389.1.92668 WP_000619389.1.92693 WP_000619389.1.92708 WP_000619389.1.92719 WP_000619389.1.92742 WP_000619389.1.92750 WP_000619389.1.92767 WP_000619389.1.92780 WP_000619389.1.92781 WP_000619389.1.92792 WP_000619389.1.92793 WP_000619389.1.92796 WP_000619389.1.92819 WP_000619389.1.92845 WP_000619389.1.92865 WP_000619389.1.92882 WP_000619389.1.92886 WP_000619389.1.92932 WP_000619389.1.92943 WP_000619389.1.92953 WP_000619389.1.92989 WP_000619389.1.92991 WP_000619389.1.93005 WP_000619389.1.93016 WP_000619389.1.93017 WP_000619389.1.93019 WP_000619389.1.93023 WP_000619389.1.93027 WP_000619389.1.93033 WP_000619389.1.93048 WP_000619389.1.93052 WP_000619389.1.93054 WP_000619389.1.93069 WP_000619389.1.93072 WP_000619389.1.93085 WP_000619389.1.93100 WP_000619389.1.93112 WP_000619389.1.93133 WP_000619389.1.93138 WP_000619389.1.93139 WP_000619389.1.93150 WP_000619389.1.93167 WP_000619389.1.93175 WP_000619389.1.93185 WP_000619389.1.93233 WP_000619389.1.93252 WP_000619389.1.93267 WP_000619389.1.9327 WP_000619389.1.93276 WP_000619389.1.93291 WP_000619389.1.93309 WP_000619389.1.9331 WP_000619389.1.93312 WP_000619389.1.93326 WP_000619389.1.93338 WP_000619389.1.93379 WP_000619389.1.93388 WP_000619389.1.934 WP_000619389.1.93427 WP_000619389.1.93428 WP_000619389.1.93431 WP_000619389.1.93453 WP_000619389.1.93461 WP_000619389.1.93463 WP_000619389.1.93464 WP_000619389.1.93468 WP_000619389.1.93509 WP_000619389.1.93531 WP_000619389.1.93533 WP_000619389.1.93552 WP_000619389.1.9356 WP_000619389.1.93569 WP_000619389.1.93601 WP_000619389.1.93605 WP_000619389.1.93621 WP_000619389.1.93626 WP_000619389.1.93629 WP_000619389.1.93630 WP_000619389.1.93634 WP_000619389.1.93637 WP_000619389.1.93639 WP_000619389.1.93652 WP_000619389.1.93665 WP_000619389.1.93670 WP_000619389.1.93673 WP_000619389.1.93679 WP_000619389.1.93694 WP_000619389.1.93695 WP_000619389.1.93716 WP_000619389.1.93733 WP_000619389.1.93737 WP_000619389.1.93742 WP_000619389.1.93743 WP_000619389.1.93745 WP_000619389.1.93755 WP_000619389.1.93765 WP_000619389.1.93768 WP_000619389.1.938 WP_000619389.1.93800 WP_000619389.1.93821 WP_000619389.1.93870 WP_000619389.1.93873 WP_000619389.1.93877 WP_000619389.1.939 WP_000619389.1.93900 WP_000619389.1.93918 WP_000619389.1.93921 WP_000619389.1.93922 WP_000619389.1.93939 WP_000619389.1.93951 WP_000619389.1.93952 WP_000619389.1.93971 WP_000619389.1.94008 WP_000619389.1.94011 WP_000619389.1.94025 WP_000619389.1.94028 WP_000619389.1.94035 WP_000619389.1.94040 WP_000619389.1.94057 WP_000619389.1.94069 WP_000619389.1.94156 WP_000619389.1.9416 WP_000619389.1.94176 WP_000619389.1.94187 WP_000619389.1.94190 WP_000619389.1.9420 WP_000619389.1.94213 WP_000619389.1.94232 WP_000619389.1.9426 WP_000619389.1.94271 WP_000619389.1.94282 WP_000619389.1.94298 WP_000619389.1.94302 WP_000619389.1.94317 WP_000619389.1.94343 WP_000619389.1.94353 WP_000619389.1.94367 WP_000619389.1.94388 WP_000619389.1.94404 WP_000619389.1.94417 WP_000619389.1.94429 WP_000619389.1.94430 WP_000619389.1.94436 WP_000619389.1.94445 WP_000619389.1.94446 WP_000619389.1.94468 WP_000619389.1.94475 WP_000619389.1.94497 WP_000619389.1.94507 WP_000619389.1.94516 WP_000619389.1.94523 WP_000619389.1.94542 WP_000619389.1.94544 WP_000619389.1.94548 WP_000619389.1.9457 WP_000619389.1.94578 WP_000619389.1.94580 WP_000619389.1.94589 WP_000619389.1.94619 WP_000619389.1.94626 WP_000619389.1.94646 WP_000619389.1.94653 WP_000619389.1.94676 WP_000619389.1.94686 WP_000619389.1.94690 WP_000619389.1.94692 WP_000619389.1.94695 WP_000619389.1.94704 WP_000619389.1.94727 WP_000619389.1.94738 WP_000619389.1.94739 WP_000619389.1.9474 WP_000619389.1.94753 WP_000619389.1.94754 WP_000619389.1.94764 WP_000619389.1.94787 WP_000619389.1.94790 WP_000619389.1.948 WP_000619389.1.94801 WP_000619389.1.94806 WP_000619389.1.94808 WP_000619389.1.94822 WP_000619389.1.94823 WP_000619389.1.94836 WP_000619389.1.94841 WP_000619389.1.94847 WP_000619389.1.94869 WP_000619389.1.94877 WP_000619389.1.94880 WP_000619389.1.94889 WP_000619389.1.9489 WP_000619389.1.94892 WP_000619389.1.94898 WP_000619389.1.949 WP_000619389.1.94903 WP_000619389.1.94907 WP_000619389.1.9491 WP_000619389.1.94927 WP_000619389.1.94934 WP_000619389.1.94935 WP_000619389.1.94938 WP_000619389.1.94949 WP_000619389.1.94955 WP_000619389.1.94963 WP_000619389.1.94991 WP_000619389.1.94993 WP_000619389.1.94997 WP_000619389.1.95005 WP_000619389.1.95011 WP_000619389.1.95022 WP_000619389.1.95028 WP_000619389.1.95035 WP_000619389.1.95036 WP_000619389.1.95037 WP_000619389.1.95062 WP_000619389.1.95080 WP_000619389.1.95084 WP_000619389.1.95105 WP_000619389.1.95129 WP_000619389.1.9513 WP_000619389.1.95161 WP_000619389.1.95198 WP_000619389.1.95233 WP_000619389.1.95243 WP_000619389.1.95244 WP_000619389.1.95254 WP_000619389.1.95275 WP_000619389.1.95310 WP_000619389.1.95329 WP_000619389.1.95332 WP_000619389.1.95366 WP_000619389.1.95368 WP_000619389.1.95378 WP_000619389.1.95381 WP_000619389.1.95390 WP_000619389.1.95395 WP_000619389.1.95398 WP_000619389.1.95400 WP_000619389.1.95403 WP_000619389.1.95424 WP_000619389.1.95428 WP_000619389.1.95431 WP_000619389.1.95438 WP_000619389.1.95449 WP_000619389.1.95490 WP_000619389.1.95518 WP_000619389.1.95521 WP_000619389.1.95563 WP_000619389.1.9559 WP_000619389.1.95595 WP_000619389.1.95596 WP_000619389.1.95604 WP_000619389.1.95611 WP_000619389.1.95628 WP_000619389.1.95634 WP_000619389.1.95655 WP_000619389.1.9566 WP_000619389.1.95666 WP_000619389.1.95680 WP_000619389.1.95712 WP_000619389.1.95756 WP_000619389.1.95759 WP_000619389.1.95771 WP_000619389.1.95783 WP_000619389.1.95784 WP_000619389.1.95800 WP_000619389.1.95801 WP_000619389.1.95821 WP_000619389.1.95824 WP_000619389.1.95827 WP_000619389.1.95834 WP_000619389.1.95835 WP_000619389.1.95846 WP_000619389.1.95849 WP_000619389.1.95858 WP_000619389.1.95861 WP_000619389.1.95865 WP_000619389.1.95869 WP_000619389.1.95916 WP_000619389.1.95919 WP_000619389.1.95929 WP_000619389.1.95931 WP_000619389.1.95932 WP_000619389.1.95951 WP_000619389.1.960 WP_000619389.1.96015 WP_000619389.1.96032 WP_000619389.1.96053 WP_000619389.1.96059 WP_000619389.1.96066 WP_000619389.1.96086 WP_000619389.1.96097 WP_000619389.1.96110 WP_000619389.1.96114 WP_000619389.1.96128 WP_000619389.1.96143 WP_000619389.1.96145 WP_000619389.1.9616 WP_000619389.1.96177 WP_000619389.1.96215 WP_000619389.1.96222 WP_000619389.1.96223 WP_000619389.1.96229 WP_000619389.1.96247 WP_000619389.1.96253 WP_000619389.1.96263 WP_000619389.1.96278 WP_000619389.1.96279 WP_000619389.1.96281 WP_000619389.1.96290 WP_000619389.1.96293 WP_000619389.1.96299 WP_000619389.1.96303 WP_000619389.1.9631 WP_000619389.1.96339 WP_000619389.1.96341 WP_000619389.1.96378 WP_000619389.1.96392 WP_000619389.1.96394 WP_000619389.1.9641 WP_000619389.1.96417 WP_000619389.1.96420 WP_000619389.1.96425 WP_000619389.1.96450 WP_000619389.1.96457 WP_000619389.1.96478 WP_000619389.1.96479 WP_000619389.1.96480 WP_000619389.1.96484 WP_000619389.1.9649 WP_000619389.1.96494 WP_000619389.1.965 WP_000619389.1.96541 WP_000619389.1.96558 WP_000619389.1.96562 WP_000619389.1.9657 WP_000619389.1.96585 WP_000619389.1.96608 WP_000619389.1.96609 WP_000619389.1.9661 WP_000619389.1.96617 WP_000619389.1.96633 WP_000619389.1.96650 WP_000619389.1.96659 WP_000619389.1.96676 WP_000619389.1.9668 WP_000619389.1.96680 WP_000619389.1.96683 WP_000619389.1.96695 WP_000619389.1.96701 WP_000619389.1.9671 WP_000619389.1.96725 WP_000619389.1.96743 WP_000619389.1.96753 WP_000619389.1.96759 WP_000619389.1.96762 WP_000619389.1.96769 WP_000619389.1.96779 WP_000619389.1.96796 WP_000619389.1.96797 WP_000619389.1.96817 WP_000619389.1.9682 WP_000619389.1.96820 WP_000619389.1.96850 WP_000619389.1.96864 WP_000619389.1.96894 WP_000619389.1.9690 WP_000619389.1.96907 WP_000619389.1.9691 WP_000619389.1.96924 WP_000619389.1.96932 WP_000619389.1.96936 WP_000619389.1.96944 WP_000619389.1.96971 WP_000619389.1.96984 WP_000619389.1.96989 WP_000619389.1.97011 WP_000619389.1.97027 WP_000619389.1.97049 WP_000619389.1.97059 WP_000619389.1.9708 WP_000619389.1.97119 WP_000619389.1.97123 WP_000619389.1.97147 WP_000619389.1.97160 WP_000619389.1.97170 WP_000619389.1.97193 WP_000619389.1.97195 WP_000619389.1.97200 WP_000619389.1.97226 WP_000619389.1.9723 WP_000619389.1.97231 WP_000619389.1.97238 WP_000619389.1.97247 WP_000619389.1.97248 WP_000619389.1.97269 WP_000619389.1.97279 WP_000619389.1.97282 WP_000619389.1.9729 WP_000619389.1.97292 WP_000619389.1.97344 WP_000619389.1.97351 WP_000619389.1.97356 WP_000619389.1.97360 WP_000619389.1.97361 WP_000619389.1.97379 WP_000619389.1.97387 WP_000619389.1.9740 WP_000619389.1.97402 WP_000619389.1.97418 WP_000619389.1.97421 WP_000619389.1.97434 WP_000619389.1.97437 WP_000619389.1.97439 WP_000619389.1.97459 WP_000619389.1.97464 WP_000619389.1.9747 WP_000619389.1.97490 WP_000619389.1.97502 WP_000619389.1.97513 WP_000619389.1.97525 WP_000619389.1.97527 WP_000619389.1.97538 WP_000619389.1.97544 WP_000619389.1.97549 WP_000619389.1.97560 WP_000619389.1.97571 WP_000619389.1.97619 WP_000619389.1.97632 WP_000619389.1.97654 WP_000619389.1.97667 WP_000619389.1.97675 WP_000619389.1.97677 WP_000619389.1.97685 WP_000619389.1.9770 WP_000619389.1.97705 WP_000619389.1.97711 WP_000619389.1.97770 WP_000619389.1.97775 WP_000619389.1.97778 WP_000619389.1.97789 WP_000619389.1.97798 WP_000619389.1.978 WP_000619389.1.97802 WP_000619389.1.97815 WP_000619389.1.97822 WP_000619389.1.97823 WP_000619389.1.97825 WP_000619389.1.97871 WP_000619389.1.97890 WP_000619389.1.97895 WP_000619389.1.97919 WP_000619389.1.97930 WP_000619389.1.97932 WP_000619389.1.97937 WP_000619389.1.97962 WP_000619389.1.97982 WP_000619389.1.97996 WP_000619389.1.98000 WP_000619389.1.98005 WP_000619389.1.98012 WP_000619389.1.98026 WP_000619389.1.9803 WP_000619389.1.98046 WP_000619389.1.98082 WP_000619389.1.98083 WP_000619389.1.981 WP_000619389.1.98102 WP_000619389.1.98115 WP_000619389.1.98139 WP_000619389.1.98155 WP_000619389.1.9816 WP_000619389.1.98167 WP_000619389.1.9817 WP_000619389.1.98176 WP_000619389.1.98187 WP_000619389.1.98202 WP_000619389.1.98205 WP_000619389.1.98208 WP_000619389.1.98220 WP_000619389.1.98232 WP_000619389.1.98235 WP_000619389.1.98239 WP_000619389.1.98241 WP_000619389.1.98244 WP_000619389.1.98251 WP_000619389.1.98279 WP_000619389.1.98284 WP_000619389.1.98292 WP_000619389.1.98294 WP_000619389.1.98301 WP_000619389.1.98312 WP_000619389.1.98323 WP_000619389.1.98355 WP_000619389.1.98357 WP_000619389.1.98384 WP_000619389.1.98400 WP_000619389.1.98404 WP_000619389.1.98424 WP_000619389.1.98429 WP_000619389.1.9844 WP_000619389.1.98442 WP_000619389.1.98451 WP_000619389.1.98466 WP_000619389.1.98477 WP_000619389.1.98480 WP_000619389.1.98484 WP_000619389.1.98498 WP_000619389.1.98543 WP_000619389.1.98549 WP_000619389.1.98569 WP_000619389.1.98578 WP_000619389.1.9858 WP_000619389.1.98587 WP_000619389.1.98603 WP_000619389.1.98614 WP_000619389.1.98626 WP_000619389.1.98628 WP_000619389.1.98633 WP_000619389.1.9864 WP_000619389.1.98641 WP_000619389.1.98654 WP_000619389.1.98665 WP_000619389.1.98668 WP_000619389.1.98683 WP_000619389.1.98702 WP_000619389.1.98727 WP_000619389.1.98757 WP_000619389.1.98775 WP_000619389.1.98776 WP_000619389.1.98784 WP_000619389.1.98795 WP_000619389.1.9883 WP_000619389.1.98875 WP_000619389.1.98886 WP_000619389.1.98908 WP_000619389.1.98920 WP_000619389.1.98976 WP_000619389.1.98988 WP_000619389.1.99006 WP_000619389.1.99029 WP_000619389.1.99046 WP_000619389.1.99053 WP_000619389.1.99060 WP_000619389.1.9907 WP_000619389.1.99101 WP_000619389.1.99110 WP_000619389.1.99119 WP_000619389.1.99168 WP_000619389.1.99182 WP_000619389.1.99209 WP_000619389.1.99234 WP_000619389.1.99246 WP_000619389.1.99265 WP_000619389.1.99289 WP_000619389.1.99292 WP_000619389.1.99295 WP_000619389.1.9930 WP_000619389.1.99302 WP_000619389.1.99304 WP_000619389.1.99306 WP_000619389.1.99307 WP_000619389.1.99319 WP_000619389.1.99334 WP_000619389.1.99345 WP_000619389.1.99349 WP_000619389.1.9935 WP_000619389.1.99361 WP_000619389.1.99366 WP_000619389.1.99392 WP_000619389.1.9940 WP_000619389.1.99400 WP_000619389.1.99401 WP_000619389.1.99427 WP_000619389.1.99446 WP_000619389.1.99453 WP_000619389.1.99458 WP_000619389.1.99471 WP_000619389.1.99472 WP_000619389.1.99475 WP_000619389.1.99486 WP_000619389.1.99487 WP_000619389.1.99498 WP_000619389.1.9950 WP_000619389.1.99501 WP_000619389.1.99511 WP_000619389.1.99534 WP_000619389.1.99549 WP_000619389.1.99562 WP_000619389.1.99571 WP_000619389.1.99592 WP_000619389.1.99602 WP_000619389.1.99603 WP_000619389.1.99619 WP_000619389.1.99632 WP_000619389.1.99641 WP_000619389.1.99666 WP_000619389.1.99692 WP_000619389.1.99694 WP_000619389.1.99698 WP_000619389.1.99734 WP_000619389.1.99771 WP_000619389.1.99774 WP_000619389.1.99782 WP_000619389.1.99791 WP_000619389.1.99804 WP_000619389.1.99827 WP_000619389.1.99869 WP_000619389.1.99874 WP_000619389.1.99891 WP_000619389.1.99892 WP_000619389.1.99912 WP_000619389.1.99929 WP_000619389.1.99986 YP_002414524.1.14968 YP_006121723.1.29421 YP_006777128.1.12065 YP_405119.1.10455 gi|238902505|ref|YP_002928301.1| gi|386601427|ref|YP_006102933.1| gi|82545771|ref|YP_409718.1| gi|251786664|ref|YP_003000968.1| gi|383180580|ref|YP_005458585.1| gi|157162891|ref|YP_001460209.1| gi|387618701|ref|YP_006121723.1| gi|443619477|ref|YP_007383333.1| gi|218697097|ref|YP_002404764.1| gi|387609106|ref|YP_006097962.1| gi|218707005|ref|YP_002414524.1| gi|254163342|ref|YP_003046450.1| gi|253771757|ref|YP_003034588.1| gi|544391866|ref|YP_008566555.1| gi|260846198|ref|YP_003223976.1| gi|209396437|ref|YP_002272850.1| gi|386706658|ref|YP_006170505.1| gi|117625679|ref|YP_859002.1| gi|260870140|ref|YP_003236542.1| gi|560159558|ref|YP_008852273.1| gi|384544982|ref|YP_005729046.1| gi|26250015|ref|NP_756055.1| gi|15803918|ref|NP_289954.1| gi|388479824|ref|YP_492018.1| gi|387831289|ref|YP_003351226.1| gi|260857521|ref|YP_003231412.1| gi|170018350|ref|YP_001723304.1| gi|386711294|ref|YP_006175015.1| gi|209920872|ref|YP_002294956.1| gi|386711294|ref|YP_006175015.1| gi|291284750|ref|YP_003501568.1| gi|16131290|ref|NP_417873.1| gi|387614088|ref|YP_006117204.1| gi|386641008|ref|YP_006107806.1| gi|187731025|ref|YP_001882093.1| gi|386616198|ref|YP_006135864.1| gi|218550672|ref|YP_002384463.1| gi|410480540|ref|YP_006768086.1| gi|170681204|ref|YP_001745662.1| gi|110643647|ref|YP_671377.1| gi|74313917|ref|YP_312336.1| gi|386621055|ref|YP_006140635.1| gi|386626202|ref|YP_006145930.1| gi|218555963|ref|YP_002388876.1| gi|218691690|ref|YP_002399902.1| gi|215488695|ref|YP_002331126.1| gi|170082930|ref|YP_001732250.1| 155864.Z4769 198214.SF3437 198215.S4328 199310.c4191 300267.SDY_3662 300268.SBO_3403 300269.SSON_3546 316385.ECDH10B_3589 316407.gntY 331111.EcE24377A_3889 331112.EcHS_A3611 344609.SbBS512_E3795 362663.ECP_3500 364106.UTI89_C3915 373384.SFV_3422 386585.ECs4256 405955.APECO1_3052 409438.ECSE_3681 413997.ECB_03266 439855.EcSMS35_3695 444450.ECH74115_4721 469008.ECBD_0331 481805.EcolC_0299 511145.b3414 544404.ECSP_4364 573235.ECO26_4502 574521.E2348C_3659 585034.ECIAI1_3558 585035.ECS88_3803 585054.EFER_3383 585055.EC55989_3822 585056.ECUMN_3873 585395.ECO103_4132 585396.ECO111_4223 585397.ECED1_4075 595496.BWG_3105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]