SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P63020 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P63020
Domain Number 1 Region: 95-184
Classification Level Classification E-value
Superfamily Fe-S cluster assembly (FSCA) domain-like 2.14e-25
Family NifU C-terminal domain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 1-97
Classification Level Classification E-value
Superfamily HesB-like domain 2.16e-20
Family HesB-like domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
cofactor biosynthetic process 1.65 15.21
sulfur compound metabolic process 1.487 11.24
maintenance of location 1.472 5.53
Molecular Function IC (bits) H-Score
iron-sulfur cluster binding 2.004 19.04
iron ion binding 1.952 13.43
Cellular Component IC (bits) H-Score
plastid 1.525 6.24
chloroplast stroma 2.009 6.24
mitochondrial matrix 1.611 5.17

Protein sequence

External link(s) P63020
Sequence length 191
Comment (sp|P63020|NFUA_ECOLI) Fe/S biogenesis protein NfuA KW=Complete proteome; Reference proteome OX=83333 OS=Escherichia coli (strain K12). GN=b3414, OC=Enterobacteriaceae; Escherichia.
Sequence
MIRISDAAQAHFAKLLANQEEGTQIRVFVINPGTPNAECGVSYCPPDAVEATDTALKFDL
LTAYVDELSAPYLEDAEIDFVTDQLGSQLTLKAPNAKMRKVADDAPLMERVEYMLQSQIN
PQLAGHGGRVSLMEITEDGYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGVRDL
TEHQRGEHSYY
Download sequence
Identical sequences A0A017I706 A0A023Z4P2 A0A024KR47 A0A025CQ58 A0A026V6Q9 A0A027U150 A0A028ANQ3 A0A028E940 A0A029HIJ7 A0A029IIV0 A0A029K9U5 A0A029PC64 A0A062Y6Y1 A0A064TBC5 A0A069XMI1 A0A070DFR1 A0A070DIM6 A0A070FDP7 A0A070SJT3 A0A070UX00 A0A073FRE6 A0A073G7W5 A0A073HFH5 A0A073UPR5 A0A074HRK7 A0A074IFC2 A0A080F062 A0A080FPW0 A0A080IH72 A0A090NKQ0 A0A0A0FHC8 A0A0A8UIR0 A0A0E0U4J6 A0A0E0VAT9 A0A0E0XUT6 A0A0E1M2J2 A0A0E1SYP0 A0A0E2LEE8 A0A0E2TQW3 A0A0F6C9Z9 A0A0F6FDA8 A0A0F6MIN0 A0A0G3J7G6 A0A0G3JLD8 A0A0G3KB10 A0A0H3EQL3 A0A0H3PXZ7 A0A0H9J741 A0A0M7N6P4 A0A0P8EFJ9 A0A0S3N0V9 A0A0W3CPV4 A0A125WXU1 A0A127GQH7 A0A140N5A9 A0A142H7R9 A0A170BHP0 A0A192CDB9 A0A1E2VMP0 A0A1Q8M7W0 A0A1R1T3S0 A0A1R1T863 A0A1R1U4Y7 A0A1R1U6S1 A0A1R1UK84 A0A1R1UNI2 A0A1R1VFK8 A0A1S0UR08 A0A1S6TGR9 A0A1S7CR99 A0A1S9KDG1 A0A1W2MQI4 A1AGT8 A7ZSU3 A8A5M2 B1EI66 B1IP51 B1LHL4 B1X760 B2U3M4 B5YTW5 B6I2X8 B7L4U4 B7LSB7 B7M1X0 B7MDP0 B7N147 B7NE19 B7UKB9 C3SPY2 C4ZVW3 C8TY30 C8UHP5 D2A9L8 D3GZN2 D3QTN1 D6I292 D6IEU7 D6JFZ1 D7X8R5 D7XWA6 D7Y606 D7YQK4 D7ZAF4 D8A6T3 D8AIA4 D8B3U1 D8BVW3 D8E819 D8EG75 E0IZV8 E1HN05 E1I6V3 E1IP07 E1J1W9 E2X8W3 E3PLM0 E3XSV1 E6BIH0 E7SIT7 E7TBG4 E9TFS1 E9XTA3 E9YVE1 F0JU64 F3WNW2 F4NNC8 F4SQE5 F4TLF5 F4V7B1 F4VK50 F5NA40 F5P316 F8X8W3 G0F783 H1C0P0 H4IH79 H4IY59 H4JE19 H4KN13 H4LI87 H4UQC7 H9UXU2 I0VW53 I2RF39 I2RT94 I2SV40 I2UI68 I2WEL5 I2X038 I2X5K2 I4T7R1 I6B7Z9 I6CB07 I6D0Z6 I6DMD9 I6FDH7 I6FJW1 J2Z1G8 J7QS21 K0XB25 K4VG11 K4XBH6 L2VFC7 L2VMP1 L2X832 L3C2L3 L3NVX6 L3PXY0 L3QC12 L4IYR2 L4V4H9 L9HW04 M9EC83 M9FBP1 M9FNL5 M9KUZ4 N3EXM0 N4NDX3 N4PCH6 P63020 P63021 P63022 P63023 Q0SZQ1 Q0TC53 Q1R5M0 Q31VL8 Q32AM7 Q3YWL1 R8XGI2 S0TTQ4 S0VQ37 S0WVN0 S0XH85 S0YBP1 S1CJ63 S1D5M3 S1EAJ2 S1G278 S1GJD6 S1HTE2 S1INE5 S1L518 S1NWH8 T5UIM9 T5ZZW7 T6LVE7 T8KEB5 T9AY73 T9CLG2 T9FZ87 T9S336 U9XJV4 U9Y553 U9YG43 U9Z6M6 V0A8A4 V0AZF8 V0R7D4 V0SCE8 V0TU38 V0UYQ1 V0XEY5 V0Y4M8 V0YEI2 V1AR31 V2RTV7 V2UCY2 V6FCZ6 V6FU57 V8FI82 V8JMV4 W0AS75 W1B9E2 W1ETQ0 W1WLZ1 W8ZXG6
gi|218697097|ref|YP_002404764.1| gi|15803918|ref|NP_289954.1| gi|386621055|ref|YP_006140635.1| gi|170082930|ref|YP_001732250.1| gi|218691690|ref|YP_002399902.1| gi|378711159|ref|YP_005276052.1| gi|170681204|ref|YP_001745662.1| gi|386711294|ref|YP_006175015.1| gi|387831289|ref|YP_003351226.1| gi|74313917|ref|YP_312336.1| gi|218550672|ref|YP_002384463.1| gi|386601427|ref|YP_006102933.1| gi|386706658|ref|YP_006170505.1| gi|544391866|ref|YP_008566555.1| gi|556553295|ref|YP_008723777.1| gi|386605992|ref|YP_006112292.1| gi|117625679|ref|YP_859002.1| gi|378711159|ref|YP_005276052.1| gi|218707005|ref|YP_002414524.1| gi|110807249|ref|YP_690769.1| gi|157155730|ref|YP_001464872.1| gi|253771757|ref|YP_003034588.1| gi|251786664|ref|YP_003000968.1| gi|291284750|ref|YP_003501568.1| gi|209396437|ref|YP_002272850.1| gi|110643647|ref|YP_671377.1| gi|218560472|ref|YP_002393385.1| gi|383180580|ref|YP_005458585.1| gi|260870140|ref|YP_003236542.1| gi|386636217|ref|YP_006155936.1| gi|386626202|ref|YP_006145930.1| gi|254795329|ref|YP_003080166.1| gi|260857521|ref|YP_003231412.1| gi|24114681|ref|NP_709191.1| gi|560159558|ref|YP_008852273.1| gi|387618701|ref|YP_006121723.1| gi|410480540|ref|YP_006768086.1| gi|91212889|ref|YP_542875.1| gi|82778770|ref|YP_405119.1| gi|387623066|ref|YP_006130694.1| gi|15833510|ref|NP_312283.1| gi|215488695|ref|YP_002331126.1| gi|386616198|ref|YP_006135864.1| gi|387508782|ref|YP_006161038.1| gi|443619477|ref|YP_007383333.1| gi|471334944|ref|YP_007558421.1| gi|387614088|ref|YP_006117204.1| gi|170018350|ref|YP_001723304.1| gi|387623066|ref|YP_006130694.1| gi|387884563|ref|YP_006314865.1| gi|218555963|ref|YP_002388876.1| gi|407471365|ref|YP_006782192.1| gi|209920872|ref|YP_002294956.1| gi|30065301|ref|NP_839472.1| gi|26250015|ref|NP_756055.1| gi|187731025|ref|YP_001882093.1| gi|251786664|ref|YP_003000968.1| gi|388479824|ref|YP_492018.1| gi|157162891|ref|YP_001460209.1| gi|238902505|ref|YP_002928301.1| gi|16131290|ref|NP_417873.1| gi|407479979|ref|YP_006777128.1| gi|387609106|ref|YP_006097962.1| 155864.Z4769 198214.SF3437 198215.S4328 199310.c4191 300267.SDY_3662 300268.SBO_3403 300269.SSON_3546 316385.ECDH10B_3589 316407.gntY 331111.EcE24377A_3889 331112.EcHS_A3611 344609.SbBS512_E3795 362663.ECP_3500 364106.UTI89_C3915 373384.SFV_3422 386585.ECs4256 405955.APECO1_3052 409438.ECSE_3681 413997.ECB_03266 439855.EcSMS35_3695 444450.ECH74115_4721 469008.ECBD_0331 481805.EcolC_0299 511145.b3414 544404.ECSP_4364 573235.ECO26_4502 574521.E2348C_3659 585034.ECIAI1_3558 585035.ECS88_3803 585054.EFER_3383 585055.EC55989_3822 585056.ECUMN_3873 585395.ECO103_4132 585396.ECO111_4223 585397.ECED1_4075 595496.BWG_3105 gi|384544982|ref|YP_005729046.1| gi|544577950|ref|YP_008573474.1| gi|260846198|ref|YP_003223976.1| APC28291 ET33 gi|386631297|ref|YP_006151017.1| gi|386641008|ref|YP_006107806.1| gi|82545771|ref|YP_409718.1| gi|254163342|ref|YP_003046450.1| gi|386711294|ref|YP_006175015.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]