SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P63252 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P63252
Domain Number 1 Region: 168-367
Classification Level Classification E-value
Superfamily E set domains 4.67e-79
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000818
Further Details:      
 
Domain Number 2 Region: 65-184
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.95e-25
Family Voltage-gated potassium channels 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P63252
Sequence length 427
Comment (sp|P63252|KCNJ2_HUMAN) Potassium channel, inwardly rectifying subfamily J member 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=KCNJ2; OC=Catarrhini; Hominidae; Homo.
Sequence
MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN
VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDASKEGK
ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVM
AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG
EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEG
MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD
LAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDIDLHNQASVPLEPRP
LRRESEI
Download sequence
Identical sequences A0A096MS42 A0A0D9S9D1 A0A2I2Z844 A0A2I3GE09 A0A2K5H9M5 A0A2K5L2F8 A0A2K5XVX4 A0A2K6K1J0 G7NJD1 G7PVA0 H2NUJ9 H2QDR5 P63252 P63253
ENSPANP00000002602 ENSPPYP00000009636 ENSP00000243457 ENSNLEP00000003183 gi|4504835|ref|NP_000882.1| ENSPPYP00000009636 NP_000882.1.87134 NP_000882.1.92137 NP_001028031.1.72884 XP_002827813.1.23681 XP_003276134.1.23891 XP_003808994.1.60992 XP_004041138.1.27298 XP_005584868.1.63531 XP_008010150.1.81039 XP_008010151.1.81039 XP_010351429.1.97406 XP_011717958.1.29376 XP_011789788.1.43180 XP_011789865.1.43180 XP_011846848.1.47321 XP_011847564.1.47321 XP_011898089.1.92194 XP_012358067.1.23891 XP_014975696.1.72884 XP_017719287.1.44346 XP_017719294.1.44346 XP_523701.2.37143 ENSPTRP00000016291 ENSGGOP00000005228 ENSMMUP00000018468 ENSPTRP00000016291 ENSMMUP00000018468 9544.ENSMMUP00000018468 9598.ENSPTRP00000016291 9600.ENSPPYP00000009636 9606.ENSP00000243457 ENSGGOP00000005228 ENSP00000243457 ENSP00000441848 ENSNLEP00000003183 ENSP00000243457 ENSP00000441848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]