SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P68431 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P68431
Domain Number 1 Region: 40-134
Classification Level Classification E-value
Superfamily Histone-fold 1.73e-89
Family Nucleosome core histones 0.00000741
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P68431
Sequence length 136
Comment (sp|P68431|H31_HUMAN) Histone H3/l KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=HIST1H3J; OC=Catarrhini; Hominidae; Homo.
Sequence
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
Download sequence
Identical sequences A0A091DP01 A0A096MPD3 A0A0D9SCL0 A0A1S3AGF4 A0A1U7QFI3 A0A1U7TPT8 A0A286X9R2 A0A2F0AZK2 A0A2K5C6D3 A0A2K5HIC7 A0A2K5KPN4 A0A2K5PIY5 A0A2K5XBV3 A0A2K6AT82 A0A2K6EG15 A0A2K6K4T2 A0A2K6NJG1 A0A2K6S6Q7 D2HWJ2 F1RVA0 F6Y7V5 F7BRX2 F7FYT1 G1QAE2 G1SAW5 G1TWR1 G3HPV9 G3SCC9 G3TR59 G5BV26 G7P2M7 H0WXG7 H2PI50 H2QQ69 I3MVX5 J9PB22 L5JT92 L5M3X4 L8IRE7 L8Y720 M3XAW8 P68431 P68432 P68433 Q6LBF0 Q6LED0 S7MY93 S9WX72 W6FIK3
ENSCHOP00000000179 ENSCHOP00000004146 ENSCHOP00000005895 ENSCHOP00000008959 ENSCHOP00000009063 ENSCHOP00000009491 ENSCHOP00000009743 ENSCAFP00000036793 ENSCAFP00000041264 ENSCAFP00000043000 PGODOG00000192291 ENSTSYP00000012293 ENSTSYP00000013238 ENSTSYP00000013572 ENSTSYP00000013676 ENSDNOP00000000453 ENSDNOP00000000457 ENSDNOP00000009436 ENSDNOP00000013268 ENSDNOP00000016425 ENSDNOP00000016901 ENSLAFP00000018067 ENSLAFP00000018749 ENSLAFP00000019049 ENSLAFP00000019836 ENSLAFP00000023559 ENSLAFP00000025084 ENSLAFP00000027715 ENSLAFP00000028516 HGL_H00000367062-1 HGL_H00000367062-2 ENSFCAP00000002674 ENSFCAP00000003629 ENSFCAP00000005540 ENSFCAP00000005651 ENSFCAP00000006289 ENSFCAP00000006647 ENSPVAP00000015684 ENSPVAP00000017013 ENSPVAP00000017101 ENSCPOP00000020699 ENSRNOP00000043798 ENSRNOP00000056090 ENSRNOP00000062107 ENSMICP00000005485 ENSMICP00000007518 ENSMICP00000007688 ENSMICP00000008356 ENSMICP00000013593 ENSMICP00000014634 ENSMICP00000015722 ENSMICP00000015727 ENSTTRP00000012758 ENSTTRP00000012770 ENSTTRP00000012772 ENSTTRP00000015862 ENSTTRP00000015866 ENSTTRP00000015869 ENSTTRP00000015889 ENSTTRP00000015895 ENSTTRP00000015898 ENSSARP00000000253 ENSSARP00000001894 ENSSARP00000001913 ENSSARP00000003812 ENSSARP00000004295 ENSSARP00000004344 ENSSARP00000004364 ENSSARP00000006546 ENSSARP00000007473 ENSSARP00000009387 ENSSARP00000012106 ENSSARP00000012179 ENSSARP00000012391 NP_001013074.1.100692 NP_001013074.1.4139 NP_001180643.1.72884 NP_001274345.1.46622 NP_003520.1.87134 NP_003520.1.92137 NP_003521.2.87134 NP_003521.2.92137 NP_003522.1.87134 NP_003522.1.92137 NP_003523.1.87134 NP_003523.1.92137 NP_003524.1.87134 NP_003524.1.92137 NP_003525.1.87134 NP_003525.1.92137 NP_003526.1.87134 NP_003526.1.92137 NP_003527.1.87134 NP_003527.1.92137 NP_003528.1.87134 NP_003528.1.92137 NP_038578.2.92730 NP_066298.1.87134 NP_066298.1.92137 NP_659539.1.92730 NP_835513.1.92730 NP_835514.1.92730 XP_001083954.1.72884 XP_001087706.1.72884 XP_001916433.1.31192 XP_002697506.1.76553 XP_002697575.1.76553 XP_002746186.1.60252 XP_002816565.1.23681 XP_002816571.1.23681 XP_002928575.1.58354 XP_003263321.1.23891 XP_003263325.1.23891 XP_003272012.1.23891 XP_003416469.1.64505 XP_003468857.1.53824 XP_003468925.2.53824 XP_003788843.1.62490 XP_003804475.1.60992 XP_003804597.1.60992 XP_003829731.1.60992 XP_003927331.1.74449 XP_003985741.1.62641 XP_003985773.1.62641 XP_004043431.1.27298 XP_004043511.1.27298 XP_004273522.1.21590 XP_004273528.1.21590 XP_004286146.1.21590 XP_004384060.1.4749 XP_004406571.1.74151 XP_004413708.1.74151 XP_004432107.1.5094 XP_004463548.1.11602 XP_004463555.1.11602 XP_004463558.1.11602 XP_004463576.1.11602 XP_004481910.1.11602 XP_004596554.1.84141 XP_004598446.1.84141 XP_004621954.1.94378 XP_004695477.1.23501 XP_004847593.1.39548 XP_005066524.1.91757 XP_005196706.1.59421 XP_005223855.1.76553 XP_005355009.1.66349 XP_005369967.1.66349 XP_005403349.1.28644 XP_005553796.1.63531 XP_005553872.1.63531 XP_005603668.1.31192 XP_005603692.1.31192 XP_005640158.1.84170 XP_005696812.1.57651 XP_005867474.1.60319 XP_005960876.1.78601 XP_006040927.1.26621 XP_006048071.1.26621 XP_006048085.1.26621 XP_006105758.1.53796 XP_006107726.1.53796 XP_006168566.1.99106 XP_006182259.1.101512 XP_006735958.1.47382 XP_006735982.1.47382 XP_006736830.1.47382 XP_006760038.1.95426 XP_006872832.1.41390 XP_006872875.1.41390 XP_006872879.1.41390 XP_006888684.1.29581 XP_006888694.1.29581 XP_006931427.1.62641 XP_006931452.1.62641 XP_006993204.1.50099 XP_006999014.1.50099 XP_007105887.1.24612 XP_007105896.1.24612 XP_007128664.1.24612 XP_007128672.1.24612 XP_007128684.1.24612 XP_007177426.1.59432 XP_007449313.1.90284 XP_007471300.1.90284 XP_007471303.1.90284 XP_007534631.1.11023 XP_007534641.1.11023 XP_007534650.1.11023 XP_007634651.1.28591 XP_007634658.1.28591 XP_007948021.1.48129 XP_007948037.1.48129 XP_007948048.1.48129 XP_007971599.1.81039 XP_007971664.1.81039 XP_007971678.1.81039 XP_008055791.1.4292 XP_008070424.1.4292 XP_008070425.1.4292 XP_008260692.1.1745 XP_008526336.1.77740 XP_008526339.1.77740 XP_008539711.1.77740 XP_008539720.1.77740 XP_008566068.1.73410 XP_008580157.1.73410 XP_008585846.1.73410 XP_008585848.1.73410 XP_008691196.1.72690 XP_008691242.1.72690 XP_008824859.1.79516 XP_008958127.1.60992 XP_008992035.1.60252 XP_009239775.1.23681 XP_009239776.1.23681 XP_009239779.1.23681 XP_009239782.1.23681 XP_010331010.1.74449 XP_010336290.1.74449 XP_010362889.1.97406 XP_010362939.1.97406 XP_010362950.1.97406 XP_010362991.1.97406 XP_010363131.1.97406 XP_010363154.1.97406 XP_010372527.1.97406 XP_010621292.1.5607 XP_010816767.1.76553 XP_010823755.1.59421 XP_010841730.1.44457 XP_010841740.1.44457 XP_010841742.1.44457 XP_010973015.1.51371 XP_011280366.1.62641 XP_011364639.1.92234 XP_011741070.1.29376 XP_011741091.1.29376 XP_011756517.1.29376 XP_011756519.1.29376 XP_011756531.1.29376 XP_011800326.1.43180 XP_011818219.1.43180 XP_011818249.1.43180 XP_011818250.1.43180 XP_011818256.1.43180 XP_011818257.1.43180 XP_011821826.1.47321 XP_011821857.1.47321 XP_011846629.1.47321 XP_011846639.1.47321 XP_011886927.1.92194 XP_011886948.1.92194 XP_011931479.1.92194 XP_012020691.1.54773 XP_012020694.1.54773 XP_012313999.1.9421 XP_012321302.1.9421 XP_012321316.1.9421 XP_012364620.1.23891 XP_012372134.1.9945 XP_012389798.1.21590 XP_012389800.1.21590 XP_012389801.1.21590 XP_012413181.1.4749 XP_012413182.1.4749 XP_012414116.1.4749 XP_012419976.1.74151 XP_012422569.1.74151 XP_012494031.1.63892 XP_012494058.1.63892 XP_012494059.1.63892 XP_012494089.1.63892 XP_012494118.1.63892 XP_012596778.1.48125 XP_012596779.1.48125 XP_012597463.1.48125 XP_012597510.1.48125 XP_012659961.1.62490 XP_012660049.1.62490 XP_012668244.1.62490 XP_012791262.1.94378 XP_012928646.1.39548 XP_013204542.1.66349 XP_013359239.1.28644 XP_013359240.1.28644 XP_013359241.1.28644 XP_013359242.1.28644 XP_013377252.1.28644 XP_013377253.1.28644 XP_013844399.1.46622 XP_013965998.1.84170 XP_013966077.1.84170 XP_013966115.1.84170 XP_014303293.1.53796 XP_014303295.1.53796 XP_014412653.1.101512 XP_014412654.1.101512 XP_014412655.1.101512 XP_014448833.1.99106 XP_014589723.1.31192 XP_014589724.1.31192 XP_014644175.1.5094 XP_014644187.1.5094 XP_014651789.1.5094 XP_014684665.1.49734 XP_014684678.1.49734 XP_014707042.1.49734 XP_014707043.1.49734 XP_014707059.1.49734 XP_014941928.1.86478 XP_014944871.1.54773 XP_014945807.1.54773 XP_014945808.1.54773 XP_014958044.1.66739 XP_014991250.1.72884 XP_015305243.1.63531 XP_015305280.1.63531 XP_015305281.1.63531 XP_015315463.1.76553 XP_015324501.1.59421 XP_015324502.1.59421 XP_015349591.1.40921 XP_015349602.1.40921 XP_015349636.1.40921 XP_015416977.1.95426 XP_015842141.1.50099 XP_015988254.1.101085 XP_015988386.1.101085 XP_015988498.1.101085 XP_015989362.1.101085 XP_015989480.1.101085 XP_016021800.1.101085 XP_016071754.1.3490 XP_016071756.1.3490 XP_016071757.1.3490 XP_016071758.1.3490 XP_016810514.1.37143 XP_016810551.1.37143 XP_017193171.1.1745 XP_017200429.1.1745 XP_017360672.1.71028 XP_017443213.1.4139 XP_017443230.1.4139 XP_017456209.1.100692 XP_017520891.1.32401 XP_017520903.1.32401 XP_017704637.1.44346 XP_017704638.1.44346 XP_017704685.1.44346 XP_017744654.1.44346 XP_017827080.1.60252 XP_017894002.1.57651 XP_017894030.1.57651 XP_017894031.1.57651 XP_018875515.1.27298 XP_018884674.1.27298 XP_019280713.1.44245 XP_019280714.1.44245 XP_019280715.1.44245 XP_019280716.1.44245 XP_019280761.1.44245 XP_019486812.1.44202 XP_019486813.1.44202 XP_019486815.1.44202 XP_019486838.1.44202 XP_019569765.1.88060 XP_019663399.1.58354 XP_019664823.1.58354 XP_019687254.1.62641 XP_019800466.1.83887 XP_019800698.1.83887 XP_019840850.1.53367 XP_019841097.1.53367 XP_020727346.1.74333 XP_020742301.1.74333 XP_020742309.1.74333 XP_020767078.1.74333 XP_020955496.1.46622 XP_021071620.1.100879 XP_021511771.1.76796 XP_021523296.1.9421 XP_021523308.1.9421 XP_021552519.1.83697 XP_021590091.1.77405 XP_021590092.1.77405 XP_527254.2.37143 XP_854287.2.84170 XP_874006.1.59421 ENSVPAP00000007649 ENSVPAP00000008645 ENSNLEP00000003818 ENSNLEP00000003820 ENSNLEP00000022245 ENSNLEP00000022248 ENSNLEP00000022263 ENSNLEP00000022265 ENSNLEP00000022652 ENSNLEP00000022659 ENSNLEP00000022661 ENSCAFP00000036793 ENSCAFP00000041264 ENSCAFP00000043000 ENSCJAP00000020197 ENSCJAP00000020217 ENSCJAP00000020224 ENSCJAP00000020356 ENSCJAP00000020364 ENSCJAP00000020371 ENSCJAP00000034735 ENSCJAP00000042887 ENSCJAP00000045587 ENSCJAP00000046176 ENSCJAP00000048692 ENSCJAP00000049298 ENSP00000352252 ENSP00000358160 ENSP00000366999 ENSP00000480826 ENSP00000482271 ENSP00000483283 ENSP00000484095 ENSP00000484638 ENSP00000484658 ENSP00000484841 ENSETEP00000006526 ENSETEP00000007751 ENSETEP00000009000 ENSETEP00000012414 ENSETEP00000016120 ENSOGAP00000005367 ENSOGAP00000007149 ENSOGAP00000007170 ENSOGAP00000007172 ENSOGAP00000014684 ENSOGAP00000016823 ENSOGAP00000020650 ENSOGAP00000022274 ENSMLUP00000016565 ENSMLUP00000016690 ENSMLUP00000017447 ENSMLUP00000017460 ENSMLUP00000018160 ENSMLUP00000019044 ENSMLUP00000020675 ENSMLUP00000021665 ENSP00000244661 ENSP00000329554 ENSP00000350275 ENSP00000352252 ENSP00000353581 ENSP00000358160 ENSP00000366999 ENSP00000439493 ENSP00000439660 ENSP00000444823 ENSOCUP00000012430 ENSOCUP00000016203 ENSOCUP00000017475 ENSOCUP00000018750 ENSOCUP00000020482 ENSOCUP00000021508 ENSOCUP00000021886 ENSOCUP00000022596 ENSOCUP00000025513 ENSAMEP00000019534 ENSAMEP00000019542 ENSAMEP00000019593 ENSAMEP00000020613 ENSAMEP00000020650 ENSAMEP00000020729 ENSAMEP00000020996 ENSAMEP00000021000 ENSAMEP00000021010 ENSAMEP00000021012 ENSSTOP00000016270 ENSSTOP00000019131 ENSSTOP00000019813 ENSSTOP00000023595 ENSEEUP00000002495 ENSEEUP00000002603 ENSEEUP00000003900 ENSEEUP00000005072 ENSEEUP00000008159 ENSEEUP00000008499 ENSEEUP00000009470 2cv5A ENSLAFP00000018067 ENSLAFP00000018749 ENSLAFP00000019049 ENSLAFP00000019836 ENSLAFP00000023559 ENSLAFP00000025084 ENSLAFP00000027715 ENSLAFP00000028516 ENSOCUP00000012430 ENSOCUP00000016203 ENSOCUP00000017475 ENSOCUP00000018750 ENSOCUP00000020482 ENSOCUP00000021508 ENSOCUP00000021886 ENSOCUP00000022596 ENSOCUP00000025513 1u35_A 1u35_E 2cv5_A 2cv5_E 5c3i_B 5c3i_F 5c3i_J 5c3i_N 5c3i_R 5c3i_V 5xf3_A 5xf3_E 5xf4_A 5xf4_E 5xf5_A 5xf5_E 6etx_I 6etx_M ENSDORP00000004901 ENSMMUP00000031246 ENSMUSP00000079670 ENSMUSP00000089293 ENSMUSP00000089348 ENSMUSP00000097295 ENSGGOP00000001422 ENSGGOP00000025756 ENSGGOP00000028216 ENSFCAP00000016482 ENSFCAP00000018806 ENSFCAP00000023772 ENSFCAP00000024200 ENSFCAP00000024403 ENSFCAP00000024762 ENSFCAP00000025154 ENSSTOP00000016270 ENSSTOP00000019131 ENSSTOP00000019813 ENSSTOP00000023595 ENSPPYP00000018230 ENSPPYP00000018232 ENSPPYP00000018243 ENSPPYP00000018247 ENSPPYP00000018253 ENSPPYP00000018286 ENSPPYP00000023509 ENSPPYP00000023510 ENSECAP00000002129 ENSECAP00000002433 ENSECAP00000002471 ENSECAP00000003504 ENSECAP00000004440 ENSECAP00000004533 ENSECAP00000005434 ENSECAP00000005633 ENSECAP00000005785 ENSTBEP00000004513 ENSSSCP00000019466 ENSSSCP00000028127 ENSMUSP00000079670 ENSMUSP00000089293 ENSMUSP00000089348 ENSMUSP00000097295 ENSCHOP00000000179 ENSCHOP00000004146 ENSCHOP00000005895 ENSCHOP00000008959 ENSCHOP00000009063 ENSCHOP00000009491 ENSCHOP00000009743 ENSMMUP00000031246 ENSRNOP00000064431 ENSRNOP00000065546 ENSRNOP00000066480 ENSRNOP00000067217 ENSGGOP00000001422 ENSGGOP00000025756 ENSGGOP00000028216 ENSTTRP00000012758 ENSTTRP00000012770 ENSTTRP00000012772 ENSTTRP00000015862 ENSTTRP00000015866 ENSTTRP00000015869 ENSTTRP00000015889 ENSTTRP00000015895 ENSTTRP00000015898 ENSOGAP00000005367 ENSOGAP00000007149 ENSOGAP00000007170 ENSOGAP00000007172 ENSOGAP00000014684 ENSOGAP00000016823 ENSOGAP00000020650 ENSOGAP00000022274 ENSPVAP00000015684 ENSPVAP00000017013 ENSPVAP00000017101 ENSOPRP00000001120 ENSOPRP00000001143 ENSOPRP00000003122 ENSOPRP00000003155 ENSOPRP00000003166 ENSOPRP00000011446 ENSOPRP00000012831 ENSOPRP00000012845 ENSOPRP00000012874 ENSEEUP00000002495 ENSEEUP00000002603 ENSEEUP00000003900 ENSEEUP00000005072 ENSEEUP00000008159 ENSEEUP00000008499 ENSEEUP00000009470 ENSCPOP00000020699 ENSPCAP00000002388 ENSPCAP00000011064 ENSPCAP00000013205 ENSPCAP00000014925 ENSPCAP00000016017 ENSPCAP00000016033 ENSPCAP00000016055 ENSPCAP00000016067 ENSDORP00000004901 ENSSSCP00000019466 ENSSSCP00000028127 ENSVPAP00000007649 ENSVPAP00000008645 ENSMICP00000005485 ENSMICP00000007518 ENSMICP00000007688 ENSMICP00000008356 ENSMICP00000013593 ENSMICP00000014634 ENSMICP00000015722 ENSMICP00000015727 ENSTBEP00000004513 ENSBTAP00000044281 ENSBTAP00000047915 ENSBTAP00000048362 ENSBTAP00000048719 ENSBTAP00000049208 ENSBTAP00000051492 ENSBTAP00000051709 ENSBTAP00000051924 ENSBTAP00000052244 ENSBTAP00000053020 ENSPANP00000001585 ENSPANP00000009120 ENSPANP00000009518 ENSPANP00000015089 ENSPANP00000015445 ENSTSYP00000012293 ENSTSYP00000013238 ENSTSYP00000013572 ENSTSYP00000013676 ENSETEP00000006526 ENSETEP00000007751 ENSETEP00000009000 ENSETEP00000012414 ENSETEP00000016120 ENSCJAP00000020197 ENSCJAP00000020273 ENSCJAP00000034735 ENSPTRP00000028251 ENSPTRP00000030385 ENSPTRP00000030388 ENSPTRP00000030410 ENSPTRP00000030412 ENSPTRP00000030453 ENSPTRP00000060361 ENSPTRP00000061012 ENSPTRP00000061121 ENSMLUP00000016565 ENSMLUP00000016690 ENSMLUP00000017447 ENSMLUP00000017460 ENSMLUP00000018160 ENSMLUP00000019044 ENSMLUP00000020675 ENSMLUP00000021665 ENSP00000244661 ENSP00000329554 ENSP00000350275 ENSP00000352252 ENSP00000353581 ENSP00000358160 ENSP00000366999 ENSP00000367062 ENSP00000439493 ENSP00000439660 ENSP00000444823 10090.ENSMUSP00000079670 10090.ENSMUSP00000089293 10090.ENSMUSP00000089346 10090.ENSMUSP00000089348 10116.ENSRNOP00000043798 10116.ENSRNOP00000056090 10116.ENSRNOP00000062107 10141.ENSCPOP00000020699 9361.ENSDNOP00000000453 9361.ENSDNOP00000000457 9361.ENSDNOP00000009436 9361.ENSDNOP00000013268 9361.ENSDNOP00000016425 9361.ENSDNOP00000016901 9544.ENSMMUP00000031246 9598.ENSPTRP00000028251 9598.ENSPTRP00000030385 9598.ENSPTRP00000030388 9598.ENSPTRP00000030401 9598.ENSPTRP00000030410 9598.ENSPTRP00000030412 9598.ENSPTRP00000030453 9598.ENSPTRP00000030454 9600.ENSPPYP00000018230 9600.ENSPPYP00000018232 9600.ENSPPYP00000018243 9600.ENSPPYP00000018247 9600.ENSPPYP00000018253 9600.ENSPPYP00000018286 9600.ENSPPYP00000023509 9600.ENSPPYP00000023510 9606.ENSP00000230495 9606.ENSP00000244661 9606.ENSP00000319632 9606.ENSP00000329554 9606.ENSP00000350275 9606.ENSP00000352252 9606.ENSP00000353581 9606.ENSP00000353783 9606.ENSP00000358160 9606.ENSP00000366999 9685.ENSFCAP00000002674 9685.ENSFCAP00000003629 9685.ENSFCAP00000005540 9685.ENSFCAP00000005651 9685.ENSFCAP00000006289 9685.ENSFCAP00000006647 9796.ENSECAP00000002129 9796.ENSECAP00000002433 9796.ENSECAP00000002471 9796.ENSECAP00000003504 9796.ENSECAP00000004440 9796.ENSECAP00000004533 9796.ENSECAP00000005434 9796.ENSECAP00000005633 9796.ENSECAP00000005785 9823.ENSSSCP00000001181 9823.ENSSSCP00000001184 9823.ENSSSCP00000001187 9823.ENSSSCP00000001194 9823.ENSSSCP00000001196 9823.ENSSSCP00000001205 9823.ENSSSCP00000001247 9913.ENSBTAP00000044281 9913.ENSBTAP00000047915 9913.ENSBTAP00000048362 9913.ENSBTAP00000048719 9913.ENSBTAP00000049208 9913.ENSBTAP00000050291 9913.ENSBTAP00000051492 9913.ENSBTAP00000051709 9913.ENSBTAP00000051924 9913.ENSBTAP00000052244 9913.ENSBTAP00000053020 9913.ENSBTAP00000053030 9986.ENSOCUP00000012430 9986.ENSOCUP00000016203 9986.ENSOCUP00000017475 9986.ENSOCUP00000018750 9986.ENSOCUP00000020482 9986.ENSOCUP00000021508 9986.ENSOCUP00000021886 9986.ENSOCUP00000022596 9986.ENSOCUP00000025513 ENSECAP00000002129 ENSECAP00000002433 ENSECAP00000002471 ENSECAP00000003504 ENSECAP00000004440 ENSECAP00000004533 ENSECAP00000005434 ENSECAP00000005633 ENSECAP00000005785 ENSSARP00000000253 ENSSARP00000001894 ENSSARP00000001913 ENSSARP00000003812 ENSSARP00000004295 ENSSARP00000004344 ENSSARP00000004364 ENSSARP00000006546 ENSSARP00000007473 ENSSARP00000009387 ENSSARP00000012106 ENSSARP00000012179 ENSSARP00000012391 ENSMUSP00000079670 ENSMUSP00000089293 ENSMUSP00000139663 ENSMUSP00000140394 ENSBTAP00000044281 ENSBTAP00000047915 ENSBTAP00000048362 ENSBTAP00000048719 ENSBTAP00000049208 ENSBTAP00000051492 ENSBTAP00000051709 ENSBTAP00000051924 ENSBTAP00000052244 ENSBTAP00000053020 ENSNLEP00000003818 ENSNLEP00000003820 ENSNLEP00000022245 ENSNLEP00000022248 ENSNLEP00000022263 ENSNLEP00000022265 ENSNLEP00000022652 ENSNLEP00000022659 ENSNLEP00000022661 gi|10440560|ref|NP_066298.1| gi|21071021|ref|NP_003521.2| gi|4504281|ref|NP_003520.1| gi|4504285|ref|NP_003522.1| gi|4504287|ref|NP_003523.1| gi|4504289|ref|NP_003524.1| gi|4504291|ref|NP_003525.1| gi|4504293|ref|NP_003526.1| gi|4504295|ref|NP_003527.1| gi|4504297|ref|NP_003528.1| ENSPTRP00000028251 ENSPTRP00000030385 ENSPTRP00000030388 ENSPTRP00000030410 ENSPTRP00000030412 ENSPTRP00000030453 ENSPTRP00000060361 ENSPTRP00000061012 ENSPTRP00000061121 ENSPPYP00000018230 ENSPPYP00000018232 ENSPPYP00000018243 ENSPPYP00000018247 ENSPPYP00000018253 ENSPPYP00000018286 ENSPPYP00000023509 ENSPPYP00000023510 ENSPCAP00000002388 ENSPCAP00000011064 ENSPCAP00000013205 ENSPCAP00000014925 ENSPCAP00000016017 ENSPCAP00000016033 ENSPCAP00000016055 ENSPCAP00000016067 ENSAMEP00000019534 ENSAMEP00000019542 ENSAMEP00000019593 ENSAMEP00000020613 ENSAMEP00000020650 ENSAMEP00000020729 ENSAMEP00000020996 ENSAMEP00000021000 ENSAMEP00000021010 ENSAMEP00000021012 ENSOPRP00000001120 ENSOPRP00000001143 ENSOPRP00000003122 ENSOPRP00000003155 ENSOPRP00000003166 ENSOPRP00000011446 ENSOPRP00000012831 ENSOPRP00000012845 ENSOPRP00000012874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]