SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P81294 from Uniprot 2014_06

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P81294
Domain Number 1 Region: 23-365
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.49e-94
Family Pectate lyase-like 0.00000000000414
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
external encapsulating structure 1.708 7.82
host cell part 1.975 5.16
cytoplasmic vesicle part 1.438 4.76
vesicle membrane 1.7 4.76
clathrin-coated vesicle 2.036 4.76
coated vesicle membrane 2.045 4.76
cell wall 1.769 4.37

Protein sequence

External link(s) P81294
Sequence length 367
Comment (sp|P81294|PLY1_JUNAS) Major pollen allergen Jun a 1 OX=13101 OS=Juniperus ashei (Ozark white cedar). GN= OC=Spermatophyta; Pinidae; Cupressales; Cupressaceae; Juniperus.
Sequence
MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD
FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV
HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT
NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF
NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT
KNAGVVT
Download sequence
Identical sequences P81294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]