SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P81295 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P81295
Domain Number 1 Region: 27-225
Classification Level Classification E-value
Superfamily Osmotin, thaumatin-like protein 8.89e-77
Family Osmotin, thaumatin-like protein 0.000000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P81295
Sequence length 225
Comment (sp|P81295|PRR3_JUNAS) Pollen allergen Jun a 3 OX=13101 OS=Juniperus ashei (Ozark white cedar). GN= OC=Spermatophyta; Pinidae; Cupressales; Cupressaceae; Juniperus.
Sequence
MARVSELAFLLAATLAISLHMQEAGVVKFDIKNQCGYTVWAAGLPGGGKRLDQGQTWTVN
LAAGTASARFWGRTGCTFDASGKGSCQTGDCGGQLSCTVSGAVPATLAEYTQSDQDYYDV
SLVDGFNIPLAINPTNAQCTAPACKADINAVCPSELKVDGGCNSACNVFKTDQYCCRNAY
VDNCPATNYSKIFKNQCPQAYSYAKDDTATFACASGTDYSIVFCP
Download sequence
Identical sequences P81295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]