SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P82912 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P82912
Domain Number 1 Region: 80-194
Classification Level Classification E-value
Superfamily Translational machinery components 3.92e-37
Family Ribosomal protein L18 and S11 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
translation factor activity, RNA binding 1.831 52.05
structural constituent of ribosome 1.959 41.4
Cellular Component IC (bits) H-Score
ribosomal subunit 1.983 42.68
organellar ribosome 2.107 32.1
intracellular ribonucleoprotein complex 1.368 23.99
cytosol 1.295 12.48
mitochondrial matrix 1.611 7.51

Protein sequence

External link(s) P82912
Sequence length 194
Comment (sp|P82912|RT11_HUMAN) Mitochondrial small ribosomal subunit protein uS11m {ECO:0000303|PubMed:25838379} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MRPS11; OC=Catarrhini; Hominidae; Homo.
Sequence
MQAVRNAGSRFLRSWTWPQTAGRVVARTPAGTICTGARQLQDAAAKQKVEQNAAPSHTKF
SIYPPIPGEESSLRWAGKKFEEIPIAHIKASHNNTQIQVVSASNEPLAFASCGTEGFRNA
KKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTP
IPHNGCRPRKARKL
Download sequence
Identical sequences P82912
3j9m.AI ENSP00000317376 gi|16554609|ref|NP_073750.2| ENSP00000317376 ENSP00000317376 9606.ENSP00000317376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]