SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P83876 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P83876
Domain Number 1 Region: 3-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.39e-40
Family spliceosomal protein U5-15Kd 0.000000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
dendrite 1.582 22.67
endoplasmic reticulum lumen 1.891 20.2
transferase complex 1.369 16.72
endoplasmic reticulum subcompartment 1.59 16.72
respiratory chain complex 2.067 11.99
oxidoreductase complex 1.828 10.17
plastid 1.525 8.21
thylakoid 2.192 7.92
side of membrane 1.633 7.11
cytoplasmic side of membrane 1.952 7.11

Protein sequence

External link(s) P83876
Sequence length 142
Comment (sp|P83876|TXN4A_HUMAN) Thioredoxin-like U5 snRNP protein U5-15kD KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TXNL4A; OC=Catarrhini; Hominidae; Homo.
Sequence
MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL
VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVY
RGARKGRGLVVSPKDYSTKYRY
Download sequence
Identical sequences A0A096N314 A0A0P6J5I6 A0A1U7Q668 A0A1U7UAZ1 D3ZSW5 F7GUX1 F7H0V3 G1RAF0 G3QRD0 H0W8R8 H0XWY1 I3NDL4 K7CG23 P83876 P83877
ENSNLEP00000010197 1qgv.A 1syx.A 1syx.C 1syx.E 3jcr.E ENSTSYP00000008627 ENSMUSP00000025464 10090.ENSMUSP00000115320 10116.ENSRNOP00000023737 10141.ENSCPOP00000019375 9544.ENSMMUP00000002155 9606.ENSP00000269601 1qgvA ENSOPRP00000010110 ENSRNOP00000023737 ENSMUSP00000115320 ENSP00000269601 ENSMUSP00000115320 gi|5729802|ref|NP_006692.1| ENSPANP00000006712 cath|current|1qgvA00/2-138 cath|current|1syxA00/3-137 cath|current|1syxC00/3-137 cath|current|1syxE00/3-137 ENSOGAP00000020624 ENSGGOP00000005173 ENSMMUP00000002154 ENSMMUP00000002155 ENSCPOP00000019375 ENSRNOP00000023737 ENSNLEP00000010197 ENSP00000269601 ENSTSYP00000008627 ENSSTOP00000022461 ENSCJAP00000018629 ENSSTOP00000022461 ENSOPRP00000010110 ENSP00000269601 ENSCPOP00000019375 ENSCJAP00000018629 ENSOGAP00000020624 ENSGGOP00000005173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]