SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P83876 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P83876
Domain Number 1 Region: 3-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.39e-40
Family spliceosomal protein U5-15Kd 0.000000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P83876
Sequence length 142
Comment (sp|P83876|TXN4A_HUMAN) Thioredoxin-like U5 snRNP protein U5-15kD KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TXNL4A; OC=Catarrhini; Hominidae; Homo.
Sequence
MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL
VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVY
RGARKGRGLVVSPKDYSTKYRY
Download sequence
Identical sequences A0A096N314 A0A0P6J5I6 A0A1U7Q668 A0A1U7UAZ1 A0A250YA31 A0A286X7A6 A0A2I3GR22 A0A2J8T7G8 A0A2K5D1W4 A0A2K5JTC3 A0A2K5N7S2 A0A2K5U5Y9 A0A2K6BAD2 A0A2K6L776 A0A2K6PYL8 D3ZSW5 F7GUX1 F7H0V3 G3QRD0 H0XWY1 I3NDL4 K7CG23 P83876 P83877
ENSCJAP00000018629 ENSP00000269601 ENSCPOP00000019375 ENSMUSP00000115320 ENSOPRP00000010110 ENSCPOP00000019375 ENSCJAP00000018629 ENSMMUP00000002154 ENSRNOP00000023737 ENSGGOP00000005173 ENSMUSP00000115320 ENSTSYP00000008627 ENSP00000269601 ENSOGAP00000020624 ENSOGAP00000020624 1qgv.A 1syx.A 1syx.C 1syx.E 3jcr.E ENSSTOP00000022461 ENSP00000269601 ENSRNOP00000023737 ENSTSYP00000008627 1qgvA ENSSTOP00000022461 ENSNLEP00000010197 cath|current|1qgvA00/2-138 cath|current|1syxA00/3-137 cath|current|1syxC00/3-137 cath|current|1syxE00/3-137 ENSMMUP00000002155 ENSGGOP00000005173 NP_001247795.1.72884 NP_001296097.1.100692 NP_001296097.1.4139 NP_006692.1.87134 NP_006692.1.92137 NP_079575.1.92730 XP_002757397.3.60252 XP_003280237.1.23891 XP_003463363.1.53824 XP_003501886.1.69978 XP_003788435.1.62490 XP_003805244.1.60992 XP_004059627.1.27298 XP_004579468.1.84141 XP_004640264.1.9945 XP_004662685.1.11716 XP_004861962.1.39548 XP_004861963.1.39548 XP_005065471.1.91757 XP_005334421.1.77405 XP_005356357.1.66349 XP_005356358.1.66349 XP_005373179.1.28644 XP_005586417.1.63531 XP_006165832.1.99106 XP_006526550.1.92730 XP_006973929.1.50099 XP_006973930.1.50099 XP_008011891.1.81039 XP_008062432.1.4292 XP_008581854.1.73410 XP_010360317.1.97406 XP_010642482.1.5607 XP_010642487.1.5607 XP_010642494.1.5607 XP_011752282.1.29376 XP_011789757.1.43180 XP_011789758.1.43180 XP_011938969.1.92194 XP_012328921.1.9421 XP_012361838.1.23891 XP_012644374.1.48125 XP_015355095.1.40921 XP_015355096.1.40921 XP_016789458.1.37143 XP_017657745.1.79516 XP_017657746.1.79516 XP_017729298.1.44346 XP_020017771.1.5219 XP_020017772.1.5219 XP_021070073.1.100879 XP_021495728.1.76796 XP_021495729.1.76796 ENSNLEP00000010197 10090.ENSMUSP00000115320 10116.ENSRNOP00000023737 10141.ENSCPOP00000019375 9544.ENSMMUP00000002155 9606.ENSP00000269601 ENSPANP00000006712 ENSMUSP00000025464 ENSOPRP00000010110 gi|5729802|ref|NP_006692.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]