SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q00796 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q00796
Domain Number 1 Region: 10-181
Classification Level Classification E-value
Superfamily GroES-like 5.53e-56
Family Alcohol dehydrogenase-like, N-terminal domain 0.0000000915
Further Details:      
 
Domain Number 2 Region: 148-316
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.35e-36
Family Alcohol dehydrogenase-like, C-terminal domain 0.0000000631
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q00796
Sequence length 357
Comment (sp|Q00796|DHSO_HUMAN) L-iditol 2-dehydrogenase KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SORD; OC=Catarrhini; Hominidae; Homo.
Sequence
MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNF
IVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFC
ATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCG
AGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQL
GCKPEVTIECTGAEASIQAGIYATRSGGNLVLVGLGSEMTTVPLLHAAIREVDIKGVFRY
CNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP
Download sequence
Identical sequences Q00796
NP_003095.2.87134 NP_003095.2.92137 gi|156627571|ref|NP_003095.2| 9606.ENSP00000267814 ENSP00000267814 ENSP00000267814 ENSP00000267814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]