SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q00987 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q00987
Domain Number 1 Region: 18-120
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 5.36e-51
Family SWIB/MDM2 domain 0.00000381
Further Details:      
 
Domain Number 2 Region: 189-283
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 5.49e-25
Family SWIB/MDM2 domain 0.028
Further Details:      
 
Domain Number 3 Region: 290-334
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 9.42e-20
Family Ran binding protein zinc finger-like 0.0000507
Further Details:      
 
Domain Number 4 Region: 437-485
Classification Level Classification E-value
Superfamily RING/U-box 0.000000765
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q00987
Sequence length 491
Comment (sp|Q00987|MDM2_HUMAN) p53-binding protein Mdm2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MDM2; OC=Catarrhini; Hominidae; Homo.
Sequence
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGT
SVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQ
RKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVP
DCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQ
DKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
Download sequence
Identical sequences Q00987
HR4740 XP_005268929.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]