SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q02413 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q02413
Domain Number 1 Region: 145-283
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-25
Family Cadherin 0.00029
Further Details:      
 
Domain Number 2 Region: 262-356
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000514
Family Cadherin 0.00097
Further Details:      
 
Domain Number 3 Region: 75-157
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000257
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 375-487
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000642
Family Cadherin 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q02413
Sequence length 1049
Comment (sp|Q02413|DSG1_HUMAN) Pemphigus foliaceus antigen KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=DSG1; OC=Catarrhini; Hominidae; Homo.
Sequence
MDWSFFRVVAMLFIFLVVVEVNSEFRIQVRDYNTKNGTIKWHSIRRQKREWIKFAAACRE
GEDNSKRNPIAKIHSDCAANQQVTYRISGVGIDQPPYGIFVINQKTGEINITSIVDREVT
PFFIIYCRALNSMGQDLERPLELRVRVLDINDNPPVFSMATFAGQIEENSNANTLVMILN
ATDADEPNNLNSKIAFKIIRQEPSDSPMFIINRNTGEIRTMNNFLDREQYGQYALAVRGS
DRDGGADGMSAECECNIKILDVNDNIPYMEQSSYTIEIQENTLNSNLLEIRVIDLDEEFS
ANWMAVIFFISGNEGNWFEIEMNERTNVGILKVVKPLDYEAMQSLQLSIGVRNKAEFHHS
IMSQYKLKASAISVTVLNVIEGPVFRPGSKTYVVTGNMGSNDKVGDFVATDLDTGRPSTT
VRYVMGNNPADLLAVDSRTGKLTLKNKVTKEQYNMLGGKYQGTILSIDDNLQRTCTGTIN
INIQSFGNDDRTNTEPNTKITTNTGRQESTSSTNYDTSTTSTDSSQVYSSEPGNGAKDLL
SDNVHFGPAGIGLLIMGFLVLGLVPFLMICCDCGGAPRSAAGFEPVPECSDGAIHSWAVE
GPQPEPRDITTVIPQIPPDNANIIECIDNSGVYTNEYGGREMQDLGGGERMTGFELTEGV
KTSGMPEICQEYSGTLRRNSMRECREGGLNMNFMESYFCQKAYAYADEDEGRPSNDCLLI
YDIEGVGSPAGSVGCCSFIGEDLDDSFLDTLGPKFKKLADISLGKESYPDLDPSWPPQST
EPVCLPQETEPVVSGHPPISPHFGTTTVISESTYPSGPGVLHPKPILDPLGYGNVTVTES
YTTSDTLKPSVHVHDNRPASNVVVTERVVGPISGADLHGMLEMPDLRDGSNVIVTERVIA
PSSSLPTSLTIHHPRESSNVVVTERVIQPTSGMIGSLSMHPELANAHNVIVTERVVSGAG
VTGISGTTGISGGIGSSGLVGTSMGAGSGALSGAGISGGGIGLSSLGGTASIGHMRSSSD
HHFNQTIGSASPSTARSRITKYSTVQYSK
Download sequence
Identical sequences Q02413
9606.ENSP00000257192 gi|119703744|ref|NP_001933.2| ENSP00000257192 NP_001933.2.87134 NP_001933.2.92137 ENSP00000257192 ENSP00000257192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]