SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q03405 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q03405
Domain Number 1 Region: 109-209
Classification Level Classification E-value
Superfamily Snake toxin-like 1.7e-44
Family Extracellular domain of cell surface receptors 0.00000168
Further Details:      
 
Domain Number 2 Region: 215-295
Classification Level Classification E-value
Superfamily Snake toxin-like 1.96e-18
Family Extracellular domain of cell surface receptors 0.0000134
Further Details:      
 
Domain Number 3 Region: 23-101
Classification Level Classification E-value
Superfamily Snake toxin-like 3.59e-16
Family Extracellular domain of cell surface receptors 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q03405
Sequence length 335
Comment (sp|Q03405|UPAR_HUMAN) Monocyte activation antigen Mo3 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PLAUR; OC=Catarrhini; Hominidae; Homo.
Sequence
MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEEL
ELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISC
GSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNG
FHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGP
MNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDV
QYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
Download sequence
Identical sequences Q03405
9606.ENSP00000339328 NP_002650.1.87134 NP_002650.1.92137 gi|4505865|ref|NP_002650.1| ENSP00000339328 PLAUR Q03405 ENSP00000339328 ENSP00000339328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]