SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q04206 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q04206
Domain Number 1 Region: 18-196
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.62e-73
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000116
Further Details:      
 
Domain Number 2 Region: 191-323
Classification Level Classification E-value
Superfamily E set domains 3.97e-51
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
STAT cascade 2.2 79.11
mesenchymal cell proliferation 2.237 48.51
response to radiation 1.519 38.12
regulation of hormone levels 1.605 33.19
cell-cell signaling 1.346 33.19
secretion 1.506 33.19
regulation of muscle cell differentiation 1.665 33.19
signal release 2.071 33.19
cellular response to hormone stimulus 1.578 29.84
response to growth hormone 2.247 29.84
Cellular Component IC (bits) H-Score
extracellular space 1.3 24.85
receptor complex 1.469 18.75
integral component of plasma membrane 1.428 16.98
transporter complex 1.698 16.98
plasma membrane protein complex 1.527 16.98
plastid 1.525 16.16
transferase complex 1.369 15.74
chromosomal region 1.996 12.66
cytoplasmic region 1.567 11.18
potassium channel complex 2.152 8.71

Protein sequence

External link(s) Q04206
Sequence length 551
Comment (sp|Q04206|TF65_HUMAN) Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RELA; OC=Catarrhini; Hominidae; Homo.
Sequence
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY
DEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA
VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ
GIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM
DFSALLSQISS
Download sequence
Identical sequences G3SHV6 Q04206
ENSP00000311508 gi|223468676|ref|NP_068810.3| 9606.ENSP00000384273 ENSP00000384273 ENSP00000384273 ENSGGOP00000027696 ENSGGOP00000011529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]