SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q04759 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q04759
Domain Number 1 Region: 377-683
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.7e-97
Family Protein kinases, catalytic subunit 0.0000000000148
Further Details:      
 
Domain Number 2 Region: 2-123
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.14e-23
Family PLC-like (P variant) 0.0000366
Further Details:      
 
Domain Number 3 Region: 215-285
Classification Level Classification E-value
Superfamily Cysteine-rich domain 8.97e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00017
Further Details:      
 
Domain Number 4 Region: 143-211
Classification Level Classification E-value
Superfamily Cysteine-rich domain 7.33e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q04759
Sequence length 706
Comment (sp|Q04759|KPCT_HUMAN) nPKC-theta KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PRKCQ; OC=Catarrhini; Hominidae; Homo.
Sequence
MSPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTF
DAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGKTEIWLELKPQGRMLMNAR
YFLEMSDTKDMNEFETEGFFALHQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFV
WGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYK
SPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQ
ARCLRDTEQIFREGPVEIGLPCSIKNEARPPCLPTPGKREPQGISWESPLDEVDKMCHLP
EPELNKERPSLQIKLKIEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDD
DVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSR
ATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKTNTFC
GTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPR
WLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPFD
CSNFDKEFLNEKPRLSFADRALINSMDQNMFRNFSFMNPGMERLIS
Download sequence
Identical sequences Q04759
ENSP00000263125 9606.ENSP00000263125 HR4459 NP_001310194.1.87134 NP_001310194.1.92137 NP_006248.1.87134 NP_006248.1.92137 XP_006717528.1.92137 XP_016871899.1.92137 gi|5453976|ref|NP_006248.1| ENSP00000263125 ENSP00000263125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]