SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q05048 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q05048
Domain Number 1 Region: 102-424
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.72e-58
Family WD40-repeat 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q05048
Sequence length 431
Comment (sp|Q05048|CSTF1_HUMAN) Cleavage stimulation factor 50 kDa subunit KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CSTF1; OC=Catarrhini; Hominidae; Homo.
Sequence
MYRTKVGLKDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMEN
DDTAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDG
QLIATGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLA
FHPTEQILASGSRDYTLKLFDYSKPSAKRAFKYIQEAEMLRSISFHPSGDFILVGTQHPT
LRLYDINTFQCFVSCNPQDQHTDAICSVNYNSSANMYVTGSKDGCIKLWDGVSNRCITTF
EKAHDGAEVCSAIFSKNSKYILSSGKDSVAKLWEISTGRTLVRYTGAGLSGRQVHRTQAV
FNHTEDYVLLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFR
ARFWYRRSTTD
Download sequence
Identical sequences A0A0D9RSB2 A0A2K5ED97 A0A2K5K0L4 A0A2K5LSI0 A0A2K5RAF0 A0A2K5XK69 A0A2K6BAS1 A0A2K6MPG0 A0A2K6NBP7 F7GJ78 G1R5V2 G2HEA5 G3QW97 G7N4H3 H2P2C7 Q05048 Q4R7X3
ENSNLEP00000008574 ENSNLEP00000024317 gi|4557491|ref|NP_001315.1| gi|75709217|ref|NP_001028693.1| gi|75709220|ref|NP_001028694.1| ENSCJAP00000020780 ENSPTRP00000023478 ENSCJAP00000020780 ENSPPYP00000012457 ENSP00000217109 NP_001028693.1.87134 NP_001028693.1.92137 NP_001028694.1.87134 NP_001028694.1.92137 NP_001233291.1.37143 NP_001315.1.87134 NP_001315.1.92137 XP_002747744.1.60252 XP_003253013.1.23891 XP_003253014.1.23891 XP_003253015.1.23891 XP_003806194.1.60992 XP_003806195.1.60992 XP_003806196.1.60992 XP_005569452.1.63531 XP_005569453.1.63531 XP_008011731.1.81039 XP_008011741.1.81039 XP_008994399.1.60252 XP_008994400.1.60252 XP_009232001.1.23681 XP_009232002.1.23681 XP_009232003.1.23681 XP_009435676.1.37143 XP_009435677.1.37143 XP_010354994.1.97406 XP_011526902.1.92137 XP_011721094.1.29376 XP_011721095.1.29376 XP_011792099.1.43180 XP_011792100.1.43180 XP_011792101.1.43180 XP_011833526.1.47321 XP_011833527.1.47321 XP_011833528.1.47321 XP_011914344.1.92194 XP_011914345.1.92194 XP_012322918.1.9421 XP_012322919.1.9421 XP_012367374.1.23891 XP_015004223.1.72884 XP_015004224.1.72884 XP_017392074.1.71028 XP_017392075.1.71028 XP_017392076.1.71028 XP_017725841.1.44346 XP_017725842.1.44346 XP_017725843.1.44346 XP_018872788.1.27298 XP_018872790.1.27298 XP_018872791.1.27298 ENSP00000217109 ENSPPYP00000012457 ENSPPYP00000024472 ENSGGOP00000007048 ENSGGOP00000007048 ENSNLEP00000008574 ENSP00000387968 9598.ENSPTRP00000023478 9600.ENSPPYP00000012457 9606.ENSP00000217109 ENSPTRP00000023478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]