SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q05066 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q05066
Domain Number 1 Region: 56-141
Classification Level Classification E-value
Superfamily HMG-box 1.17e-26
Family HMG-box 0.00000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q05066
Sequence length 204
Comment (sp|Q05066|SRY_HUMAN) Testis-determining factor KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SRY; OC=Catarrhini; Hominidae; Homo.
Sequence
MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRV
KRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMH
REKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQL
GHLPPINAASSPQQRDRYSHWTKL
Download sequence
Identical sequences A7WPU8 Q05066
ENSP00000372547 gi|4507225|ref|NP_003131.1| ENSP00000372547 9606.ENSP00000372547 NP_003131.1.92137 ENSP00000372547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]