SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q06416 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q06416
Domain Number 1 Region: 138-212
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 5.69e-31
Family POU-specific domain 0.00028
Further Details:      
 
Domain Number 2 Region: 230-292
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000012
Family Homeodomain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q06416
Sequence length 359
Comment (sp|Q06416|P5F1B_HUMAN) Octamer-binding transcription factor 3-like KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=OCT4PG1, OC=Catarrhini; Hominidae; Homo.
Sequence
MAGHLASDFAFSPPPGGGGDGPWGAEPGWVDPLTWLSFQGPPGGPGIGPGVGPGSEVWGI
PPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGVGVESNSNGASPEPCTVPPG
AVKLEKEKLEQNPEKSQDIKALQKELEQFAKLLKQKRITLGYTQADVGLILGVLFGKVFS
QKTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLMQARKRKRTSIENR
VRGNLENLFLQCPKPTLQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAA
GSPFSGGPVSFPPAPGPHFGTPGYGSPHFTALYSSVPFPEGEVFPPVSVITLGSPMHSN
Download sequence
Identical sequences Q06416
9606.ENSP00000375557 gi|227430410|ref|NP_001153014.1| ENSP00000419298 ENSP00000375557 ENSP00000375557 ENSP00000419298 NP_001153014.1.87134 NP_001153014.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]