SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q06609 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q06609
Domain Number 1 Region: 101-335
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.66e-60
Family RecA protein-like (ATPase-domain) 0.000000000893
Further Details:      
 
Domain Number 2 Region: 17-85
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 3.14e-18
Family DNA repair protein Rad51, N-terminal domain 0.0000694
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q06609
Sequence length 339
Comment (sp|Q06609|RAD51_HUMAN) RAD51 homolog A KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RAD51; OC=Catarrhini; Hominidae; Homo.
Sequence
MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
INIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL
SGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA
RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL
YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
Download sequence
Identical sequences A0A096NTH7 A0A0D9R5C5 A0A1D5QVN1 A0A2I3H1V5 A0A2I3SZ08 A0A2K5VNC1 A0A2K6NAH8 H2NMV0 Q06609
ENSP00000267868 5jzc.A 5jzc.B 5jzc.C 5jzc.D 5jzc.E 5jzc.F 5jzc.G 5np7.A 5np7.B 5np7.C 5np7.D 5np7.E 5np7.F 5np7.G ENSMMUP00000029962 9600.ENSPPYP00000007198 9606.ENSP00000267868 ENSNLEP00000003845 ENSPPYP00000007198 ENSP00000267868 ENSNLEP00000003845 NP_002866.2.87134 NP_002866.2.92137 XP_001144621.1.37143 XP_002825350.1.23681 XP_003266786.1.23891 XP_003826633.1.60992 XP_005559254.1.63531 XP_006720689.1.92137 XP_008015187.1.81039 XP_008015188.1.81039 XP_010386841.1.97406 XP_011520159.1.92137 XP_011520160.1.92137 XP_011520161.1.92137 XP_011520162.1.92137 XP_014997429.1.72884 XP_014997430.1.72884 XP_014997431.1.72884 XP_016783439.1.37143 ENSPANP00000016348 ENSPTRP00000011825 gi|19924133|ref|NP_002866.2| ENSPTRP00000011825 trt001000151.1 ENSPPYP00000007198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]