SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q06609 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q06609
Domain Number 1 Region: 101-335
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.66e-60
Family RecA protein-like (ATPase-domain) 0.000000000893
Further Details:      
 
Domain Number 2 Region: 17-85
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 3.14e-18
Family DNA repair protein Rad51, N-terminal domain 0.0000694
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
actin cytoskeleton 1.374 29.03
cilium 1.675 22.42
transporter complex 1.698 22.26
ATPase complex 2.002 22.1
ciliary part 1.819 21.32
chromosomal part 1.512 20.08
midbody 2.182 17.6
side of membrane 1.633 16
nucleoplasm part 1.369 15.74
protein-DNA complex 1.923 15.74

Protein sequence

External link(s) Q06609
Sequence length 339
Comment (sp|Q06609|RAD51_HUMAN) RAD51 homolog A KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RAD51; OC=Catarrhini; Hominidae; Homo.
Sequence
MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
INIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL
SGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA
RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL
YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
Download sequence
Identical sequences A0A096NTH7 A0A0D9R5C5 A0A1D5QVN1 G1QSC7 H2NMV0 H2Q966 Q06609
ENSNLEP00000003845 5jzc.A 5jzc.B 5jzc.C 5jzc.D 5jzc.E 5jzc.F 5jzc.G 5np7.A 5np7.B 5np7.C 5np7.D 5np7.E 5np7.F 5np7.G ENSPPYP00000007198 ENSPTRP00000011825 trt001000151.1 ENSMMUP00000029962 ENSPANP00000016348 ENSNLEP00000003845 ENSP00000267868 ENSP00000267868 ENSPPYP00000007198 ENSPTRP00000011825 gi|19924133|ref|NP_002866.2| 9600.ENSPPYP00000007198 9606.ENSP00000267868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]