SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q07837 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q07837
Domain Number 1 Region: 116-556
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.73e-109
Family Amylase, catalytic domain 0.000000452
Further Details:      
 
Weak hits

Sequence:  Q07837
Domain Number - Region: 569-649
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.016
Family alpha-Amylases, C-terminal beta-sheet domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q07837
Sequence length 685
Comment (sp|Q07837|SLC31_HUMAN) b(0,+)-type amino acid transport protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SLC3A1; OC=Catarrhini; Hominidae; Homo.
Sequence
MAEDKSKRDSIEMSMKGCQTNNGFVHNEDILEQTPDPGSSTDNLKHSTRGILGSQEPDFK
GVQPYAGMPKEVLFQFSGQARYRIPREILFWLTVASVLVLIAATIAIIALSPKCLDWWQE
GPMYQIYPRSFKDSNKDGNGDLKGIQDKLDYITALNIKTVWITSFYKSSLKDFRYGVEDF
REVDPIFGTMEDFENLVAAIHDKGLKLIIDFIPNHTSDKHIWFQLSRTRTGKYTDYYIWH
DCTHENGKTIPPNNWLSVYGNSSWHFDEVRNQCYFHQFMKEQPDLNFRNPDVQEEIKEIL
RFWLTKGVDGFSLDAVKFLLEAKHLRDEIQVNKTQIPDTVTQYSELYHDFTTTQVGMHDI
VRSFRQTMDQYSTEPGRYRFMGTEAYAESIDRTVMYYGLPFIQEADFPFNNYLSMLDTVS
GNSVYEVITSWMENMPEGKWPNWMIGGPDSSRLTSRLGNQYVNVMNMLLFTLPGTPITYY
GEEIGMGNIVAANLNESYDINTLRSKSPMQWDNSSNAGFSEASNTWLPTNSDYHTVNVDV
QKTQPRSALKLYQDLSLLHANELLLNRGWFCHLRNDSHYVVYTRELDGIDRIFIVVLNFG
ESTLLNLHNMISGLPAKMRIRLSTNSADKGSKVDTSGIFLDKGEGLIFEHNTKNLLHRQT
AFRDRCFVSNRACYSSVLNILYTSC
Download sequence
Identical sequences A0A0S2Z4E1 Q07837
gi|187423904|ref|NP_000332.2| ENSP00000260649 ENSP00000260649 NP_000332.2.87134 NP_000332.2.92137 ENSP00000260649 9606.ENSP00000260649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]