SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q12824 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q12824
Sequence length 385
Comment (sp|Q12824|SNF5_HUMAN) SNF5 homolog KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SMARCB1; OC=Catarrhini; Hominidae; Homo.
Sequence
MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEER
KKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYL
REQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENA
SQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASA
IRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKENSPEKFALKLCSE
LGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAE
MEKKIRDQDRNTRRMRRLANTAPAW
Download sequence
Identical sequences A0A096NWL0 A0A0D9RFV1 A0A1S3F003 A0A1U7QMN7 A0A1U7UFK0 A0A250YH15 A0A2J8XRG8 A0A2K5LCI0 A0A2K5S7Q7 A0A2K6C9E4 A0A2K6KAA0 A0A2K6P8N0 A0A2K6UG45 E2RMD3 F2Z4X9 G1M4Y7 G1P3N2 G5B642 H9FYR5 I3MJ39 K7AHP5 L5KW07 M3W1I0 Q12824 Q6ZWP4 Q9Z0H3 U3FFQ1
ENSP00000263121 ENSMUSP00000000925 ENSPTRP00000040536 ENSAMEP00000014404 ENSSSCP00000010743 ENSMUSP00000000925 gi|27545326|ref|NP_003064.2| HR6367 mmt007120406.1 mmt007120406.2 mmt007120406.3 mmt007120406.4 mmt007120406.5 mmt007120406.6 mmt007120406.7 mmt007120406.8 mmt007120406.9 ENSMUSP00000000925 NP_003064.2.87134 NP_003064.2.92137 NP_035548.1.92730 XP_001169712.1.37143 XP_001929472.1.46622 XP_002763527.1.60252 XP_002925094.1.58354 XP_003477997.1.53824 XP_003803336.1.62490 XP_003804675.1.60992 XP_003938569.1.74449 XP_003995030.1.62641 XP_004276087.1.21590 XP_004386214.1.4749 XP_004400581.1.74151 XP_004443139.1.5094 XP_004592077.1.84141 XP_004636367.1.9945 XP_004680989.1.23501 XP_004742548.1.14098 XP_004843636.1.39548 XP_005070800.1.91757 XP_005334528.1.77405 XP_005360263.1.66349 XP_005396475.1.28644 XP_006048180.1.26621 XP_006099560.1.53796 XP_006140265.1.99106 XP_006256380.1.100692 XP_006768932.1.95426 XP_006874999.1.41390 XP_006908731.1.64745 XP_007127249.1.24612 XP_007196365.1.59432 XP_007451083.1.90284 XP_007973303.1.81039 XP_008064646.1.4292 XP_008140871.1.99482 XP_008537384.1.77740 XP_008537385.1.77740 XP_008566790.1.73410 XP_008772065.1.100692 XP_008838842.1.79516 XP_010368133.1.97406 XP_010985623.1.51371 XP_011354274.1.92234 XP_011766735.1.29376 XP_011816232.1.43180 XP_011944966.1.92194 XP_012013163.1.54773 XP_012309531.1.9421 XP_012499586.1.63892 XP_012632198.1.48125 XP_012869973.1.60039 XP_014706041.1.49734 XP_015005310.1.72884 XP_015355820.1.40921 XP_015982683.1.101085 XP_016059792.1.3490 XP_017353580.1.71028 XP_017744982.1.44346 XP_017916396.1.57651 XP_019292967.1.44245 XP_019520958.1.44202 XP_019613279.1.88060 XP_020023826.1.5219 XP_020763053.1.74333 XP_021060207.1.100879 XP_021509438.1.76796 XP_021543596.1.83697 XP_857270.2.84170 ENSCAFP00000020798 ENSAMEP00000014404 ENSSSCP00000010743 ENSCAFP00000020798 ENSCPOP00000013169 ENSMLUP00000004537 ENSMLUP00000004537 ENSP00000263121 ENSP00000479330 ENSCPOP00000013169 ENSPTRP00000040536 HGL_H00000340883 ENSPANP00000017438 10090.ENSMUSP00000000925 10116.ENSRNOP00000034916 10141.ENSCPOP00000013169 9606.ENSP00000263121 9615.ENSCAFP00000020798 9823.ENSSSCP00000010743 ENSRNOP00000034916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]