SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q12840 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q12840
Domain Number 1 Region: 9-363
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.06e-123
Family Motor proteins 0.0000000000978
Further Details:      
 
Weak hits

Sequence:  Q12840
Domain Number - Region: 718-808
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0523
Family DNA repair protein MutS, domain III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q12840
Sequence length 1032
Comment (sp|Q12840|KIF5A_HUMAN) Neuronal kinesin heavy chain KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=KIF5A; OC=Catarrhini; Hominidae; Homo.
Sequence
MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVVIGGKPYVFDRVFPPNTTQE
QVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEI
LDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENMETEQKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTM
FICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETI
AKLEAELSRWRNGENVPETERLAGEEAALGAELCEETPVNDNSSIVVRIAPEERQKYEEE
IRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQRELSHLQSENDAA
KDEVKEVLQALEELAVNYDQKSQEVEEKSQQNQLLVDELSQKVATMLSLESELQRLQEVS
GHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKS
VVKRCRQLENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSLTEYMQSVELKKRHLEES
YDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESHREAHHRQLARLRDE
INEKQKTIDELKDLNQKLQLELEKLQADYEKLKSEEHEKSTKLQELTFLYERHEQSKQDL
KGLEETVARELQTLHNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQL
TKVHKQLVRDNADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRI
KEAVRYKSSGKRGHSAQIAKPVRPGHYPASSPTNPYGTRSPECISYTNSLFQNYQNLYLQ
ATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQA
KLFPLHQETAAS
Download sequence
Identical sequences A0A2I3ML31 A0A2K5JFK0 A0A2K5YNQ6 A0A2K6LCP4 A0A2K6PCV2 G7N7G4 G7PIV7 Q12840
ENSP00000408979 ENSP00000286452 gi|45446749|ref|NP_004975.2| NP_004975.2.87134 NP_004975.2.92137 XP_005571404.1.63531 XP_010387254.1.97406 XP_011781403.1.43180 XP_011843967.1.47321 XP_015007600.1.72884 XP_017714411.1.44346 ENSPANP00000001607 ENSP00000408979 9606.ENSP00000286452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]