SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q13066 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q13066
Sequence length 116
Comment (sp|Q13066|GAG2B_HUMAN) G antigen 2C KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GAGE2C; OC=Catarrhini; Hominidae; Homo.
Sequence
MSWRGRSTYRPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGED
EGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC
Download sequence
Identical sequences Q13066
ENSP00000371127 ENSP00000371144 gi|148529018|ref|NP_001091881.1| gi|4503879|ref|NP_001463.1| ENSP00000371127 ENSP00000371144 9606.ENSP00000365350 9606.ENSP00000371144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]