SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q13541 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q13541
Sequence length 118
Comment (sp|Q13541|4EBP1_HUMAN) Phosphorylated heat- and acid-stable protein regulated by insulin 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=EIF4EBP1; OC=Catarrhini; Hominidae; Homo.
Sequence
MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLM
ECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Download sequence
Identical sequences A0A2J8N7W4 H2PQ26 Q13541
ENSPPYP00000020757 ENSPTRP00000041478 9598.ENSPTRP00000041478 9600.ENSPPYP00000020757 9606.ENSP00000340691 NP_004086.1.87134 NP_004086.1.92137 XP_002819050.1.23681 XP_004046943.1.27298 XP_531121.2.37143 ENSGGOP00000021459 ENSPTRP00000041478 ENSGGOP00000021459 ENSPPYP00000020757 ENSP00000340691 ENSP00000340691 ENSP00000340691 GO.35153 gi|4758258|ref|NP_004086.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]