SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q13619 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q13619
Domain Number 1 Region: 56-399
Classification Level Classification E-value
Superfamily Cullin repeat-like 2.15e-167
Family Cullin repeat 0.0000198
Further Details:      
 
Domain Number 2 Region: 400-671
Classification Level Classification E-value
Superfamily Cullin homology domain 8.05e-101
Family Cullin homology domain 0.000000000109
Further Details:      
 
Domain Number 3 Region: 671-759
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.08e-27
Family SCF ubiquitin ligase complex WHB domain 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q13619
Sequence length 759
Comment (sp|Q13619|CUL4A_HUMAN) Cullin-4A KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CUL4A; OC=Catarrhini; Hominidae; Homo.
Sequence
MADEAPRKGSFSALVGRTNGLTKPAALAAAPAKPGGAGGSKKLVIKNFRDRPRLPDNYTQ
DTWRKLHEAVRAVQSSTSIRYNLEELYQAVENLCSHKVSPMLYKQLRQACEDHVQAQILP
FREDSLDSVLFLKKINTCWQDHCRQMIMIRSIFLFLDRTYVLQNSTLPSIWDMGLELFRT
HIISDKMVQSKTIDGILLLIERERSGEAVDRSLLRSLLGMLSDLQVYKDSFELKFLEETN
CLYAAEGQRLMQEREVPEYLNHVSKRLEEEGDRVITYLDHSTQKPLIACVEKQLLGEHLT
AILQKGLDHLLDENRVPDLAQMYQLFSRVRGGQQALLQHWSEYIKTFGTAIVINPEKDKD
MVQDLLDFKDKVDHVIEVCFQKNERFVNLMKESFETFINKRPNKPAELIAKHVDSKLRAG
NKEATDEELERTLDKIMILFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLK
HECGAAFTSKLEGMFKDMELSKDIMVHFKQHMQNQSDSGPIDLTVNILTMGYWPTYTPME
VHLTPEMIKLQEVFKAFYLGKHSGRKLQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLL
MFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNGEF
KHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELY
NQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA
Download sequence
Identical sequences H2Q7U2 Q13619
2hyeC gi|57165424|ref|NP_001008895.1| HR3342 ENSPTRP00000010296 ENSP00000364589 NP_001008895.1.87134 NP_001008895.1.92137 XP_003314265.1.37143 XP_016781091.1.37143 ENSP00000364589 ENSPTRP00000010296 2hye_C ENSP00000364589 9606.ENSP00000364589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]