SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q13956 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q13956
Sequence length 83
Comment (sp|Q13956|CNCG_HUMAN) Retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PDE6H; OC=Catarrhini; Hominidae; Homo.
Sequence
MSDNTTLPAPASNQGPTTPRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDI
TVICPWEAFSHLELHELAQFGII
Download sequence
Identical sequences Q13956
ENSP00000266395 ENSP00000266395 gi|5453868|ref|NP_006196.1| 9606.ENSP00000266395 ENSP00000266395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]