SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q14511 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q14511
Domain Number 1 Region: 6-83
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-17
Family SH3-domain 0.0011
Further Details:      
 
Weak hits

Sequence:  Q14511
Domain Number - Region: 623-695
Classification Level Classification E-value
Superfamily STAT 0.0471
Family STAT 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q14511
Sequence length 834
Comment (sp|Q14511|CASL_HUMAN) Enhancer of filamentation 1 p55 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NEDD9; OC=Catarrhini; Hominidae; Homo.
Sequence
MKYKNLMARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRV
KLLIGPMQETASSHEQPASGLMQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQV
PTGHGTQEQEVYQVPPSVQRSIGGTSGPHVGKKVITPVRTGHGYVYEYPSRYQKDVYDIP
PSHTTQGVYDIPPSSAKGPVFSVPVGEIKPQGVYDIPPTKGVYAIPPSACRDEAGLREKD
YDFPPPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPN
HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLHNPPDAKGSRD
LVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTAIERLQRLQQAL
EMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELFLKEYLHFVKGAVANAACLPELI
LHNKMKRELQRVEDSHQILSQTSHDLNECSWSLNILAINKPQNKCDDLDRFVMVAKTVPD
DAKQLTTTINTNAEALFRPGPGSLHLKNGPESIMNSTEYPHGGSQGQLLHPGDHKAQAHN
KALPPGLSKEQAPDCSSSDGSERSWMDDYDYVHLQGKEEFERQQKELLEKENIMKQNKMQ
LEHHQLSQFQLLEQEITKPVENDISKWKPSQSLPTTNSGVSAQDRQLLCFYYDQCETHFI
SLLNAIDALFSCVSSAQPPRIFVAHSKFVILSAHKLVFIGDTLTRQVTAQDIRNKVMNSS
NQLCEQLKTIVMATKMAALHYPSTTALQEMVHQVTDLSRNAQLFKRSLLEMATF
Download sequence
Identical sequences Q14511
ENSP00000368759 NP_006394.1.87134 NP_006394.1.92137 HR5554 NYSGXRC-13133a 9606.ENSP00000368759 ENSP00000368745 gi|5453680|ref|NP_006394.1| ENSP00000368759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]