SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q14641 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q14641
Domain Number - Region: 13-57,109-138
Classification Level Classification E-value
Superfamily Insulin-like 0.00118
Family Insulin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q14641
Sequence length 139
Comment (sp|Q14641|INSL4_HUMAN) Early placenta insulin-like peptide A chain KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=INSL4; OC=Catarrhini; Hominidae; Homo.
Sequence
MASLFRSYLPAIWLLLSQLLRESLAAELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLE
SGRPKEMVSTSNNKDGQALGTTSEFIPNLSPELKKPLSEGQPSLKKIILSRKKRSGRHRF
DPFCCEVICDDGTSVKLCT
Download sequence
Identical sequences Q14641
ENSP00000239316 gi|4504711|ref|NP_002186.1| HR87 NP_002186.1.87134 NP_002186.1.92137 9606.ENSP00000239316 ENSP00000239316 ENSP00000239316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]