SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q14722 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q14722
Domain Number 1 Region: 89-411
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 5.5e-93
Family Aldo-keto reductases (NADP) 0.0000000000445
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
axon 1.501 37.11
potassium channel complex 2.152 24.85
integral component of plasma membrane 1.428 17.39
main axon 2.037 11.13
transporter complex 1.698 11.08
extrinsic component of plasma membrane 2.107 9.47
cytoplasmic side of membrane 1.952 8.82
cytosol 1.295 8.62
side of membrane 1.633 4.3

Protein sequence

External link(s) Q14722
Sequence length 419
Comment (sp|Q14722|KCAB1_HUMAN) Kv-beta-1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=KCNAB1; OC=Catarrhini; Hominidae; Homo.
Sequence
MLAARTGAAGSQISEENTKLRRQSGFSVAGKDKSPKKASENAKDSSLSPSGESQLRARQL
ALLREVEMNWYLKLCDLSSEHTTVCTTGMPHRNLGKSGLRVSCLGLGTWVTFGGQISDEV
AERLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETE
RGLSRKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTS
RWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPLAC
GIISGKYGNGVPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAV
AWCLRNEGVSSVLLGSSTPEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDYRS
Download sequence
Identical sequences Q14722
ENSP00000419952 9606.ENSP00000419952 ENSP00000374285 gi|27436966|ref|NP_751892.1| ENSP00000419952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]