SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q15008 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q15008
Domain Number 1 Region: 284-366
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.21e-18
Family PCI domain (PINT motif) 0.062
Further Details:      
 
Domain Number 2 Region: 87-212
Classification Level Classification E-value
Superfamily TPR-like 0.0000467
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q15008
Sequence length 389
Comment (sp|Q15008|PSMD6_HUMAN) p42A KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PSMD6; OC=Catarrhini; Hominidae; Homo.
Sequence
MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKS
LDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGA
LTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRL
KVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKV
IKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMR
IHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPD
SKNWQYQETIKKGDLLLNRVQKLSRVINM
Download sequence
Identical sequences A0A2I3RF19 G3QP60 H2PAC2 Q15008
gi|7661914|ref|NP_055629.1| ENSPPYP00000015370 ENSPTRP00000026037 ENSP00000295901 ENSPTRP00000026037 NP_055629.1.87134 NP_055629.1.92137 XP_002813608.1.23681 XP_003811648.1.60992 XP_004035897.1.27298 XP_520898.3.37143 ENSP00000295901 400559 Hs7661914___KOG0687 ENSGGOP00000004345 ENSPPYP00000015370 5gjq_R 5gjr_5 5gjr_R 5l4k_R 5ln3_R 5m32_m 5t0c_AY 5t0c_BY 5t0g_Y 5t0h_Y 5t0i_Y 5t0j_Y 9598.ENSPTRP00000026037 9600.ENSPPYP00000015370 9606.ENSP00000295901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]