SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q15077 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q15077
Domain Number 1 Region: 17-324
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.28e-60
Family Rhodopsin-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q15077
Sequence length 328
Comment (sp|Q15077|P2RY6_HUMAN) P2Y purinoceptor 6 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=P2RY6; OC=Catarrhini; Hominidae; Homo.
Sequence
MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTR
TAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCI
SFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDL
SPPALATHYMPYGMALTVIGFLLPFAALLACYCLLACRLCRQDGPAEPVAQERRGKAARM
AVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPIL
FYFTQKKFRRRPHELLQKLTAKWQRQGR
Download sequence
Identical sequences A0A024R5I9 Q15077
ENSP00000309771 ENSP00000377215 ENSP00000377216 ENSP00000377217 ENSP00000442551 ENSP00000442990 ENSP00000443427 ENSP00000445652 ENSP00000480966 9606.ENSP00000309771 ENSP00000309771 ATCG3D_192 ENSP00000309771 ENSP00000377215 ENSP00000377216 ENSP00000377217 ENSP00000442551 ENSP00000442990 ENSP00000443427 ENSP00000445652 NP_001264133.1.87134 NP_001264133.1.92137 NP_001264134.1.87134 NP_001264134.1.92137 NP_001264135.1.87134 NP_001264135.1.92137 NP_001264136.1.87134 NP_001264136.1.92137 NP_789766.1.87134 NP_789766.1.92137 NP_789767.1.87134 NP_789767.1.92137 NP_789768.1.87134 NP_789768.1.92137 XP_005274079.1.92137 XP_006718634.1.92137 XP_011543379.1.92137 XP_011543381.1.92137 gi|29029608|ref|NP_789766.1| gi|29029610|ref|NP_789767.1| gi|29029612|ref|NP_789768.1| gi|4758864|ref|NP_004145.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]