SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q15109 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q15109
Domain Number 1 Region: 240-309
Classification Level Classification E-value
Superfamily Immunoglobulin 1.08e-16
Family I set domains 0.031
Further Details:      
 
Domain Number 2 Region: 22-117
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000187
Family I set domains 0.027
Further Details:      
 
Domain Number 3 Region: 143-210
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000052
Family C2 set domains 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q15109
Sequence length 404
Comment (sp|Q15109|RAGE_HUMAN) Receptor for advanced glycosylation end products KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=AGER; OC=Catarrhini; Hominidae; Homo.
Sequence
MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEA
WKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQI
PGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRH
PETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQL
VVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS
CVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGV
ILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP
Download sequence
Identical sequences A0A1U9X785 Q15109
NP_001127.1.87134 NP_001127.1.92137 NYSGRC-IgSF-RAGE_HUMAN hsi002012890.1 gi|10835203|ref|NP_001127.1| ENSP00000364217 ENSP00000395812 ENSP00000397227 ENSP00000401068 ENSP00000409457 ENSP00000364217 ENSP00000395812 ENSP00000397227 ENSP00000401068 ENSP00000409457 9606.ENSP00000364217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]