SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q15393 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q15393
Domain Number 1 Region: 1-361
Classification Level Classification E-value
Superfamily ECOD 4.9e-162
Family ECOD 0.0041
Further Details:      
 
Domain Number 2 Region: 14-373
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.13e-140
Family 0.025
Further Details:      
 
Domain Number 3 Region: 742-805,917-1130
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.74e-91
Family 0.0027
Further Details:      
 
Domain Number 4 Region: 447-463,595-741
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.2e-60
Family 0.043
Further Details:      
 
Domain Number 5 Region: 399-490,531-634
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.61e-39
Family 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q15393
Sequence length 1217
Comment (sp|Q15393|SF3B3_HUMAN) Spliceosome-associated protein 130 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SF3B3; OC=Catarrhini; Hominidae; Homo.
Sequence
MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFG
VIRSLMAFRLTGGTKDYIVVGSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQF
LAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENP
MFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPG
GSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKSMFF
FLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQ
IAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFCQIADLANEDT
PQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVN
ATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPG
KKTIVKCAVNQRQVVIALTGGELVYFEMDPSGQLNEYTERKEMSADVVCMSLANVPPGEQ
RSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGTEKQDELGERGSI
GFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSW
LSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFP
LQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAA
AFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTG
EDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVL
IGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQ
LIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRG
LLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDF
FQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRT
PPEVSKKLEDIRTRYAF
Download sequence
Identical sequences A0A096NR05 A0A0P6J5X4 A0A1S3EY05 A0A1U7TYF5 A0A250Y758 A0A2K5DHY5 A0A2K5MM51 A0A2K5PHY0 A0A2K6C5R0 A0A2K6K0K7 A0A2K6RX73 A0A2K6U0D8 A0JN52 F7F1S5 G3QL55 G7NQQ5 G7Q1L4 H2QBG5 I3M925 Q15393
ENSCJAP00000027292 ENSBTAP00000014050 ENSPTRP00000014195 ENSCJAP00000027292 5o9z_w 5z56_3 5z57_3 5z58_3 6ff4_v ENSPTRP00000014195 ENSP00000305790 ENSBTAP00000014050 9598.ENSPTRP00000014195 9606.ENSP00000305790 ENSP00000305790 ENSP00000305790 NP_001071319.1.59421 NP_001071319.1.76553 NP_036558.3.87134 NP_036558.3.92137 XP_001107025.2.72884 XP_002761182.1.60252 XP_003829523.1.60992 XP_003939977.1.74449 XP_004057969.1.27298 XP_004600596.1.94378 XP_004659625.1.11716 XP_004842940.1.39548 XP_005318464.1.77405 XP_005403542.1.28644 XP_005592554.1.63531 XP_005894391.1.15283 XP_006152717.1.99106 XP_008061503.1.4292 XP_008138211.1.99482 XP_008255820.1.1745 XP_008580536.1.73410 XP_008833202.1.79516 XP_010381248.1.97406 XP_010381249.1.97406 XP_010849022.1.44457 XP_011755837.1.29376 XP_011893831.1.92194 XP_011893917.1.92194 XP_012292841.1.9421 XP_012292842.1.9421 XP_012868322.1.60039 XP_013221381.1.77405 XP_014444891.1.99106 XP_015351586.1.40921 XP_016051870.1.3490 XP_016051877.1.3490 XP_016051881.1.3490 XP_016051887.1.3490 XP_017371762.1.71028 XP_017724236.1.44346 XP_017724237.1.44346 XP_019834981.1.53367 XP_020017228.1.5219 XP_020017229.1.5219 XP_020017230.1.5219 XP_511081.3.37143 gi|54112121|ref|NP_036558.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]