SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q15669 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q15669
Domain Number 1 Region: 5-170
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.2e-45
Family G proteins 0.0000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q15669
Sequence length 191
Comment (sp|Q15669|RHOH_HUMAN) Translocation three four protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RHOH; OC=Catarrhini; Hominidae; Homo.
Sequence
MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTA
GNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTPVLVVATQTDQ
REMGPHRASCVNAMEGKKLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRR
RLFSINECKIF
Download sequence
Identical sequences Q15669 Q6ICP4
ENSP00000371219 ENSP00000425010 ENSP00000478248 ENSP00000480192 ENSP00000480379 ENSP00000480772 ENSP00000481566 ENSP00000481746 ENSP00000481836 ENSP00000482947 NP_001265288.1.87134 NP_001265288.1.92137 NP_001265289.1.87134 NP_001265289.1.92137 NP_001265290.1.87134 NP_001265290.1.92137 NP_001265291.1.87134 NP_001265291.1.92137 NP_001265292.1.87134 NP_001265292.1.92137 NP_001265293.1.87134 NP_001265293.1.92137 NP_001265294.1.87134 NP_001265294.1.92137 NP_001265295.1.87134 NP_001265295.1.92137 NP_001265296.1.87134 NP_001265296.1.92137 NP_001265297.1.87134 NP_001265297.1.92137 NP_001265298.1.87134 NP_001265298.1.92137 NP_004301.1.87134 NP_004301.1.92137 XP_004038626.1.27298 XP_004038627.1.27298 XP_004038628.1.27298 XP_004038630.1.27298 XP_004038632.1.27298 XP_004038633.1.27298 XP_004038634.1.27298 XP_004038635.1.27298 XP_004038637.1.27298 XP_011511994.1.92137 XP_016863677.1.92137 XP_016863678.1.92137 XP_018881653.1.27298 XP_018881654.1.27298 XP_018881655.1.27298 ENSGGOP00000026536 ENSP00000371219 ENSP00000425010 ENSP00000371219 9606.ENSP00000371219 gi|4757770|ref|NP_004301.1| ENSGGOP00000026536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]