SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q16520 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q16520
Domain Number 1 Region: 26-82
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.000000000000156
Family Leucine zipper domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q16520
Sequence length 125
Comment (sp|Q16520|BATF_HUMAN) SF-HT-activated gene 2 protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=BATF; OC=Catarrhini; Hominidae; Homo.
Sequence
MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESED
LEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSS
PRFQP
Download sequence
Identical sequences A0A096NS54 A0A0D9RI62 A0A2K5ICU6 A0A2K5LV17 A0A2K5YR53 A0A2K6BB52 A0A2K6LXK6 A0A2K6R373 F7HAG6 G1S3B7 G3QIL9 G7PB13 H2NLU6 H2Q8N1 Q16520
ENSPANP00000015874 ENSP00000286639 NP_001253011.1.72884 NP_006390.1.87134 NP_006390.1.92137 XP_001160120.1.37143 XP_002825001.1.23681 XP_003260826.1.23891 XP_003824236.1.60992 XP_004055518.1.27298 XP_005561877.1.63531 XP_007985516.1.81039 XP_010380975.1.97406 XP_011763809.1.29376 XP_011804920.1.43180 XP_011836952.1.47321 XP_011926297.1.92194 XP_017736031.1.44346 ENSPPYP00000006829 9544.ENSMMUP00000005113 9598.ENSPTRP00000011135 9600.ENSPPYP00000006829 9606.ENSP00000286639 ENSPTRP00000011135 ENSPPYP00000006829 ENSGGOP00000002232 ENSP00000286639 ENSMMUP00000005113 ENSP00000286639 ENSNLEP00000020005 ENSMMUP00000005113 ENSGGOP00000002232 ENSNLEP00000020005 ENSPTRP00000011135 HR6459 gi|5453563|ref|NP_006390.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]