SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q16873 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q16873
Domain Number 1 Region: 2-132
Classification Level Classification E-value
Superfamily MAPEG domain-like 2.35e-41
Family MAPEG domain 0.000000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q16873
Sequence length 150
Comment (sp|Q16873|LTC4S_HUMAN) Leukotriene-C(4) synthase KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=LTC4S; OC=Catarrhini; Hominidae; Homo.
Sequence
MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYF
PLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVA
LAALGLLAHFLPAALRAALLGRLRTLLPWA
Download sequence
Identical sequences G3RP28 Q16873
ENSGGOP00000017547 ENSGGOP00000017547 ENSP00000292596 ENSP00000292596 9606.ENSP00000292596 ENSP00000385627 NP_665874.1.87134 NP_665874.1.92137 gi|22035629|ref|NP_665874.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]