SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q17RB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q17RB0
Sequence length 113
Comment (sp|Q17RB0|RTL8B_HUMAN) Mammalian retrotransposon derived protein 8B KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RTL8B; OC=Catarrhini; Hominidae; Homo.
Sequence
MEGRVQLMKALLARPLRPAARRWRNPIPFPETFDGDTDRLPEFIVQTSSYMFVDENTFSN
DALKVTFLITRLTGPALQWVIPYIKKESPLLSDYRGFLAEMKRVFGWEEDEDF
Download sequence
Identical sequences Q17RB0
gi|118200337|ref|NP_001071641.1| ENSP00000375268 NP_001071641.1.87134 NP_001071641.1.92137 9606.ENSP00000375268 ENSP00000375268 ENSP00000375268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]