SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q17RG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q17RG1
Domain Number 1 Region: 396-497
Classification Level Classification E-value
Superfamily POZ domain 6.02e-18
Family Tetramerization domain of potassium channels 0.009
Further Details:      
 
Domain Number 2 Region: 13-105
Classification Level Classification E-value
Superfamily POZ domain 1.88e-16
Family Tetramerization domain of potassium channels 0.008
Further Details:      
 
Domain Number 3 Region: 185-254
Classification Level Classification E-value
Superfamily POZ domain 0.000000139
Family Tetramerization domain of potassium channels 0.051
Further Details:      
 
Weak hits

Sequence:  Q17RG1
Domain Number - Region: 287-349
Classification Level Classification E-value
Superfamily POZ domain 0.0549
Family Tetramerization domain of potassium channels 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q17RG1
Sequence length 926
Comment (sp|Q17RG1|KCD19_HUMAN) BTB/POZ domain-containing protein KCTD19 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=KCTD19; OC=Catarrhini; Hominidae; Homo.
Sequence
MEESGMAHESAEDLFHFNVGGWHFSVPRSKLSQFPDSLLWKEASALTSSESQRLFIDRDG
STFRHVHYYLYTSKLSFSSCAELNLLYEQALGLQLMPLLQTLDNLKEGKHHLRVRPADLP
VAERASLNYWRTWKCISKPSEFPIKSPAFTGLHDKAPLGLMDTPLLDTEEEVHYCFLPLD
LVAKYPSLVTEDNLLWLAETVALIECECSEFRFIVNFLRSQKILLPDNFSNIDVLEAEVE
ILEIPALTEAVRWYRMNMGGCSPTTCSPLSPGKGARTASLESVKPLYTMALGLLVKYPDS
ALGQLRIESTLDGSRLYITGNGVLFQHVKNWLGTCRLPLTETISEVYELCAFLDKRDITY
EPIKVALKTHLEPRTLAPMDVLNEWTAEITVYSPQQIIKVYVGSHWYATTLQTLLKYPEL
LSNPQRVYWITYGQTLLIHGDGQMFRHILNFLRLGKLFLPSEFKEWPLFCQEVEEYHIPS
LSEALAQCEAYKSWTQEKESENEEAFSIRRLHVVTEGPGSLVEFSRDTKETTAYMPVDFE
DCSDRTPWNKAKGNLVRSNQMDEAEQYTRPIQVSLCRNAKRAGNPSTYSHCRGLCTNPGH
WGSHPESPPKKKCTTINLTQKSETKDPPATPMQKLISLVREWDMVNCKQWEFQPLTATRS
SPLEEATLQLPLGSEAASQPSTSAAWKAHSTASEKDPGPQAGAGAGAKDKGPEPTFKPYL
PPKRAGTLKDWSKQRTKERESPAPEQPLPEASEVDSLGVILKVTHPPVVGSDGFCMFFED
SIIYTTEMDNLRHTTPTASPQPQEVTFLSFSLSWEEMFYAQKCHCFLADIIMDSIRQKDP
KAITAKVVSLANRLWTLHISPKQFVVDLLAITGFKDDRHTQERLYSWVELTLPFARKYGR
CMDLLIQRGLSRSVSYSILGKYLQED
Download sequence
Identical sequences Q17RG1
NP_001094385.1.87134 NP_001094385.1.92137 NYSGRC-155369221 ENSP00000305702 9606.ENSP00000305702 gi|155369221|ref|NP_001094385.1| ENSP00000305702 ENSP00000305702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]