SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q17RQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q17RQ9
Sequence length 610
Comment (sp|Q17RQ9|NKPD1_HUMAN) NTPase KAP family P-loop domain-containing protein 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NKPD1; OC=Catarrhini; Hominidae; Homo.
Sequence
MQQEAAQRESEELQHVQWRPRAVSGWGVPQLLWYLVFLQPIITEVHLRRRNVQFLFIRFS
AWQYAGTDKLWAGLVTTLCEGIRRHYGALPFSVYSVLGNKPATRQDCCQSEWHCRRRVCL
GLLALLAALGLGVGLLYLSLGGHALGHGSPSGSLLKVFGGAATTLSGSGLLMAVYSVGKH
LFVSQRKKIERLVSREKFGSQLGFMCEVKKEVELLTDFLCFLEIYQRRRLRVVLEVTGLD
TCYPERVVGVLNAINTLLSDSHAPFIFILVVDPSILAACLESAGNMKGTADNGYLFLNRT
VTLPFSVPIMGRRTKLQFLHDAVQSRDDLLYREMTRKPWLPGDAGGESAQLLAVQAQAGT
ERGQGRIDDEAARRIQEALFCLHDERDCLYEYVPDNVVSMRRIVNTVPITVRLLQQQQQQ
GDFGGPTPRQAVAWVVLANQWPCRLSWALQCLEDRQQTGGAPEGRARLWDVFRDNSRELH
TMTKALQNVLDLDGDPELFERFLGADFPFTVAEAQSLLRCTVNLDHSIRRRMGLIRAVSA
LKPPSPPKSPTRDTPHAAHRANSASRAPPSGRASGQAGEGHHTGDLAHRGKLWPVACALF
RPGQSSPGGP
Download sequence
Identical sequences J3KNK3 Q17RQ9
ENSP00000401739 ENSP00000468649 ENSP00000401739 ENSP00000468649 9606.ENSP00000401739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]