SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q2M1V0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2M1V0
Domain Number 1 Region: 70-141
Classification Level Classification E-value
Superfamily Homeodomain-like 1.28e-26
Family Homeodomain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q2M1V0
Sequence length 245
Comment (sp|Q2M1V0|ISX_HUMAN) RAX-like homeobox KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ISX; OC=Catarrhini; Hominidae; Homo.
Sequence
MCAEVGPALCRGMERNSLGCCEAPKKLSLSFSIEAILKRPARRSDMDRPEGPGEEGPGEA
AASGSGLEKPPKDQPQEGRKSKRRVRTTFTTEQLHELEKIFHFTHYPDVHIRSQLAARIN
LPEARVQIWFQNQRAKWRKQEKIGNLGAPQQLSEASVALPTNLDVAGPTWTSTALRRLAP
PTSCCPSAQDQLASAWFPAWITLLPAHPWETQPVPGLPIHQTCIPVLCILPPPHPKWGSI
CATST
Download sequence
Identical sequences Q2M1V0
gi|57232759|ref|NP_001008494.1| ENSP00000311492 ENSP00000386037 ENSP00000311492 9606.ENSP00000311492 NP_001290437.1.87134 NP_001290437.1.92137 ENSP00000311492 ENSP00000386037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]