SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q2VPA4 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2VPA4
Domain Number 1 Region: 156-224
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.67e-17
Family Complement control module/SCR domain 0.0000173
Further Details:      
 
Domain Number 2 Region: 95-167
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.67e-17
Family Complement control module/SCR domain 0.00013
Further Details:      
 
Domain Number 3 Region: 412-484
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.64e-17
Family Complement control module/SCR domain 0.0000314
Further Details:      
 
Domain Number 4 Region: 289-351
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000027
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 5 Region: 231-294
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000236
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 6 Region: 354-422
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000917
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 7 Region: 473-542
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000124
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 8 Region: 35-101
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000175
Family Complement control module/SCR domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
integral component of plasma membrane 1.428 19.95
receptor complex 1.469 19.95
plasma membrane receptor complex 1.824 19.95
extracellular space 1.3 14.73
vacuolar part 1.567 13.84
sperm part 2.202 12.71
cell surface 1.3 12.63
lytic vacuole 1.553 9.95
Golgi lumen 2.224 9.15
cilium 1.675 8.91
Molecular Function IC (bits) H-Score
cargo receptor activity 1.665 57.46
growth factor binding 1.592 53.53
complement binding 2.132 42.15
carbohydrate binding 1.847 36.49
opsonin binding 2.121 30.69
carboxylic acid binding 1.502 13
sialic acid binding 2.239 13
endopeptidase activity 1.571 9.51
serine hydrolase activity 1.589 7.75
heparin binding 1.414 5.17

Protein sequence

External link(s) Q2VPA4
Sequence length 569
Comment (sp|Q2VPA4|CR1L_HUMAN) Complement C4b-binding protein CR-1-like protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CR1L; OC=Catarrhini; Hominidae; Homo.
Sequence
MAPPVRLERPFPSRRFPGLLLAALVLLLSSFSDQCNVPEWLPFARPTNLTDDFEFPIGTY
LNYECRPGYSGRPFSIICLKNSVWTSAKDKCKRKSCRNPPDPVNGMAHVIKDIQFRSQIK
YSCPKGYRLIGSSSATCIISGNTVIWDNKTPVCDRIICGLPPTIANGDFTSISREYFHYG
SVVTYHCNLGSRGKKVFELVGEPSIYCTSKDDQVGIWSGPAPQCIIPNKCTPPNVENGIL
VSDNRSLFSLNEVVEFRCQPGFGMKGPSHVKCQALNKWEPELPSCSRVCQPPPDVLHAER
TQRDKDNFSPGQEVFYSCEPGYDLRGSTYLHCTPQGDWSPAAPRCEVKSCDDFLGQLPNG
HVLFPLNLQLGAKVDFVCDEGFQLKGSSASYCVLAGMESLWNSSVPVCERKSCETPPVPV
NGMVHVITDIHVGSRINYSCTTGHRLIGHSSAECILSGNTAHWSMKPPICQQIFCPNPPA
ILNGRHTGTPLGDIPYGKEVSYTCDPHPDRGMTFNLIGESTIRRTSEPHGNGVWSSPAPR
CELPVGAGSHDALIVGKFYEVFAEEFCHL
Download sequence
Identical sequences Q2VPA4
9606.ENSP00000399885 ENSP00000421736 ENSP00000421736 gi|148922949|ref|NP_783641.1| ENSP00000421736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]