SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q4KMG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q4KMG9
Domain Number - Region: 106-135
Classification Level Classification E-value
Superfamily JAB1/MPN domain 0.0144
Family JAB1/MPN domain 0.013
Further Details:      
 
Domain Number - Region: 8-73
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0339
Family Rhodopsin-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q4KMG9
Sequence length 183
Comment (sp|Q4KMG9|TM52B_HUMAN) Transmembrane protein 52B KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TMEM52B; OC=Catarrhini; Hominidae; Homo.
Sequence
MGVRVHVVAASALLYFILLSGTRCEENCGNPEHCLTTDWVHLWYIWLLVVIGALLLLCGL
TSLCFRCCCLSRQQNGEDGGPPPCEVTVIAFDHDSTLQSTITSLQSVFGPAARRILAVAH
SHSSLGQLPSSLDTLPGYEEALHMSRFTVAMCGQKAPDLPPVPEEKQLPPTEKESTRIVD
SWN
Download sequence
Identical sequences Q4KMG9
ENSP00000298530 ENSP00000371348 ENSP00000446102 ENSP00000371348 NP_001073283.1.87134 NP_001073283.1.92137 XP_003829680.1.60992 XP_006719092.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]