SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q4PLT6 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4PLT6
Domain Number 1 Region: 27-115
Classification Level Classification E-value
Superfamily Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin 1.44e-27
Family Plant lipid-transfer and hydrophobic proteins 0.0000895
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
organelle envelope 1.405 27.27
outer membrane 2.091 27.27
symplast 2.091 14.78
cell-cell junction 1.461 8.34
plastid 1.525 6.56
cell wall 1.824 6.54
thylakoid 2.192 6
external encapsulating structure 1.722 5.99
Molecular Function IC (bits) H-Score
peptidase regulator activity 1.695 12.26
enzyme inhibitor activity 1.385 8.72
lipid transporter activity 2.073 7.19

Protein sequence

External link(s) Q4PLT6
Sequence length 117
Comment (tr|Q4PLT6|Q4PLT6_FRAAN) Non-specific lipid-transfer protein {ECO:0000256|RuleBase:RU000628} OX=3747 OS=virginiana). GN=LTP5 OC=Potentilleae; Fragariinae; Fragaria.
Sequence
MAISTAMKLSLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVPAACCNGIRSL
NSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKCGVNVPYKISTSTNCAAVK
Download sequence
Identical sequences Q4PLT6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]