SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q53FA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q53FA7
Domain Number 1 Region: 112-292
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.19e-46
Family Alcohol dehydrogenase-like, C-terminal domain 0.00089
Further Details:      
 
Domain Number 2 Region: 1-141
Classification Level Classification E-value
Superfamily GroES-like 6.24e-38
Family Alcohol dehydrogenase-like, N-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q53FA7
Sequence length 332
Comment (sp|Q53FA7|QORX_HUMAN) p53-induced gene 3 protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TP53I3; OC=Catarrhini; Hominidae; Homo.
Sequence
MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNI
LGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAA
IPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQM
AEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGL
MGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPV
LDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ
Download sequence
Identical sequences Q53FA7
ENSP00000238721 ENSP00000238721 ENSP00000337834 NP_004872.2.87134 NP_004872.2.92137 NP_671713.1.87134 NP_671713.1.92137 ENSP00000238721 ENSP00000337834 gi|22538444|ref|NP_004872.2| gi|22538446|ref|NP_671713.1| 9606.ENSP00000238721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]