SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q567V2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q567V2
Sequence length 206
Comment (sp|Q567V2|M17L2_HUMAN) Mpv17-like protein 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MPV17L2; OC=Catarrhini; Hominidae; Homo.
Sequence
MARGGWRRLRRLLSAGQLLFQGRALLVTNTLGCGALMAAGDGVRQSWEIRARPGQVFDPR
RSASMFAVGCSMGPFLHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPLLGVWYFLG
LGCLEGQTVGESCQELREKFWEFYKADWCVWPAAQFVNFLFVPPQFRVTYINGLTLGWDT
YLSYLKYRSPVPLTPPGCVALDTRAD
Download sequence
Identical sequences A0A024R7K6 G3R0J7 H2QFS8 Q567V2
ENSP00000469836 ENSP00000469836 NP_116072.2.87134 NP_116072.2.92137 XP_001173861.1.37143 XP_003817829.1.60992 XP_018871460.1.27298 gi|116235468|ref|NP_116072.2| 9598.ENSPTRP00000018248 9606.ENSP00000247712 ENSPTRP00000018248 ENSP00000247712 HR6569 ENSPTRP00000018248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]