SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q56NI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q56NI9
Domain Number - Region: 477-558
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0219
Family N-acetyl transferase, NAT 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q56NI9
Sequence length 601
Comment (sp|Q56NI9|ESCO2_HUMAN) Establishment of cohesion 1 homolog 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ESCO2; OC=Catarrhini; Hominidae; Homo.
Sequence
MAALTPRKRKQDSLKCDSLLHFTENLFPSPNKKHCFYQNSDKNEENLHCSQQEHFVLSAL
KTTEINRLPSANQGSPFKSALSTVSFYNQNKWYLNPLERKLIKESRSTCLKTNDEDKSFP
IVTEKMQGKPVCSKKNNKKPQKSLTAKYQPKYRHIKPVSRNSRNSKQNRVIYKPIVEKEN
NCHSAENNSNAPRVLSQKIKPQVTLQGGAAFFVRKKSSLRKSSLENEPSLGRTQKSKSEV
IEDSDVETVSEKKTFATRQVPKCLVLEEKLKIGLLSASSKNKEKLIKDSSDDRVSSKEHK
VDKNEAFSSEDSLGENKTISPKSTVYPIFSASSVNSKRSLGEEQFSVGSVNFMKQTNIQK
NTNTRDTSKKTKDQLIIDAGQKHFGATVCKSCGMIYTASNPEDEMQHVQHHHRFLEGIKY
VGWKKERVVAEFWDGKIVLVLPHDPSFAIKKVEDVQELVDNELGFQQVVPKCPNKIKTFL
FISDEKRVVGCLIAEPIKQAFRVLSEPIGPESPSSTECPRAWQCSDVPEPAVCGISRIWV
FRLKRRKRIARRLVDTLRNCFMFGCFLSTDEIAFSDPTPDGKLFATKYCNTPNFLVYNFN
S
Download sequence
Identical sequences Q56NI9
NP_001017420.1.87134 NP_001017420.1.92137 XP_011542723.1.92137 9606.ENSP00000306999 gi|62899035|ref|NP_001017420.1| ENSP00000306999 ENSP00000306999 ENSP00000306999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]