SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q59GN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q59GN2
Domain Number 1 Region: 3-50
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 3.92e-21
Family Ribosomal protein L39e 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q59GN2
Sequence length 51
Comment (sp|Q59GN2|R39L5_HUMAN) 60S ribosomal protein L39 pseudogene 5 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RPL39P5; OC=Catarrhini; Hominidae; Homo.
Sequence
MSSHKTFKIKQFLAKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWKRTKLGL
Download sequence
Identical sequences Q59GN2
PGOHUM00000250259 9606.ENSP00000273411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]