SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5CZ79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5CZ79
Domain Number 1 Region: 34-256
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.58e-56
Family Ankyrin repeat 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5CZ79
Sequence length 823
Comment (sp|Q5CZ79|AN20B_HUMAN) Ankyrin repeat domain-containing protein 20A pseudogene KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ANKRD20A8P; OC=Catarrhini; Hominidae; Homo.
Sequence
MKLFGFGSRRGQTAEGSIDHVYTGSGYRIRDSELQKIHRAAVKGDAAEVERCLARRSGDL
DARDKQHRTALHLACASGHVQVVTLLVNRKCQIDICDKENRTPLIQAVHCQEEACAVILL
KHGANPNLKDIYGNTALHYAVYSESTSLAEKLLSHGAHIEALDKDSNTPLLFAIICKKEK
MVEFLLKKKASTHAVDRLRRSALMLAVYYDSPGIVSILLKQNIDVFAQDMCGRDAEDYAI
SHHLTKIQQQILEHKQKILKKEKSDVGSSDESAVSIFHELRVDSLPASDDKDLSVATKQC
VPEKVSEPLPGPSHEKGNRIVNGQGEGPPAKHPSLKPTTGVEDPAVKGAVQRKNVQTLRA
EQALPVASEEEQERHERSEKKQPQVKKGNNTNKSEKIQLSENICDSTSSAAAGRLTQQRK
IGKTYPQQFPKKLKEEHDKCTLKQENEEKTNVNMLYKKNREELERKEKQYKKEVEAKQLE
PTVQSLEMKSKTARNTPNRDFHNHEETKGLMDENCILKADIAILRQEICTMKNDNLEKEN
KYLKDIKIVKETNAALEKYIKLNEEMITETAFRYQQELNDLKAENTRLNAELLKEKESKK
RLEADIESYQSRLAAAIGKHSESVKTERNVKLALERTQDVSVQVEMSSAISKVKDENEFL
TEQLSETQIKFNALKDKFRKTRDSLRKKSLALETVQNDLRKTQQQTQEMKEMYQNAEAKV
NNSTGKWNCVEERICHLQRENAWLVQQLDDVHQKEDHKEIVTNIQRGFIESGKKDLVLEE
KSKKLMNECDHLKESLFQYEREKAEGVVSIKEDKYFQTSRKKI
Download sequence
Identical sequences Q5CZ79
PGOHUM00000240189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]