SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5GH77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5GH77
Sequence length 459
Comment (sp|Q5GH77|XKR3_HUMAN) XTES KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=XKR3; OC=Catarrhini; Hominidae; Homo.
Sequence
METVFEEMDEESTGGVSSSKEEIVLGQRLHLSFPFSIIFSTVLYCGEVAFGLYMFEIYRK
ANDTFWMSFTISFIIVGAILDQIILMFFNKDLRRNKAALLFWHILLLGPIVRCLHTIRNY
HKWLKNLKQEKEETQVSITKRNTMLEREIAFSIRDNFMQQKAFKYMSVIQAFLGSVPQLI
LQMYISLTIREWPLNRALLMTFSLLSVTYGAIRCNILAIQISNDDTTIKLPPIEFFCVVM
WRFLEVISRVVTLAFFIASLKLKSLPVLLIIYFVSLLAPWLEFWKSGAHLPGNKENNSNM
VGTVLMLFLITLLYAAINFSCWSAVKLQLSDDKIIDGRQRWGHRILHYSFQFLENVIMIL
VFRFFGGKTLLNCCDSLIAVQLIISYLLATGFMLLFYQYLYPWQSGKVLPGRTENQPEAP
YYYVNIEKTEKNKNKQLRNYCHSCNRVGYFSIRKSMTCS
Download sequence
Identical sequences Q5GH77
ENSP00000331704 ENSP00000331704 NP_001305180.1.87134 NP_001305180.1.92137 NP_787074.2.87134 NP_787074.2.92137 XP_016884089.1.92137 9606.ENSP00000331704 gi|103471991|ref|NP_787074.2| ENSP00000331704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]