SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5JS54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5JS54
Sequence length 123
Comment (sp|Q5JS54|PSMG4_HUMAN) Proteasome assembly chaperone 4 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PSMG4; OC=Catarrhini; Hominidae; Homo.
Sequence
MEGLVVAAGGDVSLHNFSARLWEQLVHFHVMRLTDSLFLWVGATPHLRNLAVAMCSRYDS
IPVSTSLLGDTSDTTSTGLAQRLARKTNKQVFVSYNLQNTDSNFALLVENRIKEEMEAFP
EKF
Download sequence
Identical sequences A0A2I2ZFH8 K7BZI5 Q5JS54
NP_001122063.1.87134 NP_001122063.1.92137 XP_003311069.1.37143 ENSP00000413353 gi|190570184|ref|NP_001122063.1| ENSP00000413353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]