SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5JX71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5JX71
Sequence length 171
Comment (sp|Q5JX71|F209A_HUMAN) Protein FAM209A KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FAM209A; OC=Catarrhini; Hominidae; Homo.
Sequence
MWTLKSSLVLLLCLTCSYAFMFSSLRQKTSEPQGKVQYGEHFRIRQNLPEHTQGWLGSKW
LWLLFVVVPFVILQCQRDSEKNKEQSPPGLRGGQLHSPLKKKRNASPNKDCAFNTLMELE
VELMKFVSKVRNLKRAMATGSGSNLRLRKSEMPADPYHVTICEIWGEESSS
Download sequence
Identical sequences Q5JX71
gi|71043622|ref|NP_001012989.2| ENSP00000360379 ENSP00000360379 NP_001012989.2.87134 NP_001012989.2.92137 9606.ENSP00000360379 ENSP00000360379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]